Search Antibody, Protein, and ELISA Kit Solutions

ACLY antibody - middle region (ARP42736_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42736_P050-FITC Conjugated

ARP42736_P050-HRP Conjugated

ARP42736_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
ATP citrate lyase
Protein Name:
ATP-citrate synthase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-30537 from Santa Cruz Biotechnology.
Description of Target:
ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acety
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACLY.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACLY.
The immunogen is a synthetic peptide directed towards the middle region of human ACLY
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 93%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%; Sheep: 92%; Zebrafish: 79%
Complete computational species homology data:
Anti-ACLY (ARP42736_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ACLY (ARP42736_P050) antibody is Catalog # AAP42736 (Previous Catalog # AAPP24960)
Printable datasheet for anti-ACLY (ARP42736_P050) antibody
Sample Type Confirmation:

ACLY is strongly supported by BioGPS gene expression data to be expressed in ACHN

Target Reference:

Convertini, P; Menga, A; Andria, G; Scala, I; Santarsiero, A; Castiglione Morelli, MA; Iacobazzi, V; Infantino, V; The contribution of the citrate pathway to oxidative stress in Down syndrome. 149, 423-431 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 27502741

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...