Search Antibody, Protein, and ELISA Kit Solutions

ACKR1 Antibody - N-terminal region : FITC (ARP73814_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73814_P050 Unconjugated

ARP73814_P050-HRP Conjugated

ARP73814_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ACKR1
Official Gene Full Name:
atypical chemokine receptor 1 (Duffy blood group)
NCBI Gene Id:
2532
Protein Name:
atypical chemokine receptor 1
Swissprot Id:
Q16570
Protein Accession #:
NP_002027
Alias Symbols:
FY, Dfy, GPD, DARC, GpFy, CCBP1, CD234, WBCQ1, DARC/ACKR1
Description of Target:
The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
336
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACKR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACKR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DARC
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
CXCL5; CCL8; CCL17; CCL5; CCL7; CCL2; CXCL1; CXCL8;
Blocking Peptide:
For anti-ACKR1 (ARP73814_P050-FITC) antibody is Catalog # AAP73814
Datasheets/Manuals:
Printable datasheet for anti-ACKR1 (ARP73814_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...