ACHE Antibody - N-terminal region (ARP56761_P050)

Catalog No: ARP56761_P050

WB Suggested Anti-ACHE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Host: Rabbit
Target Name: ACHE
Sample Tissue: Human HCT116 Whole Cell
Antibody Dilution: 1ug/ml

Sample Type:
Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStop
Primary Antibody Dilution:
1:50
Secondary Antibody:
Goat anti-rabbit-cy3
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
ACHE: Green Neural crest cells:: Red
Gene Name:
ACHE
Submitted by:
Anonymous

Sample Type:
Adult mouse tectum
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit-Cy3
Secondary Antibody Dilution:
1:1000
Color/Signal Descriptions:
Red: Ache Cyan: Nissl(Neurons)
Gene Name:
ACHE
Submitted by:
Joshua R. Sanes, Molecular and Cellular Biology, Harvard University, 52 Oxford Street, Room 335, Cambridge MA 02138, Phone: 617-496-8683, FAX: 617-495-0524, email: sanesj@mcb.harvard.edu

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB, IF
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACHE
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 91%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACHE (ARP56761_P050) antibody is Catalog # AAP56761 (Previous Catalog # AAPP39618)
• Reference: Johnson,G., (2008) Biochem. J. 411 (3), 507-514

Target Info

• Gene Symbol: ACHE
• Gene Full Name: Acetylcholinesterase
• Alias Symbols: YT, ACEE, ARACHE, N-ACHE
• NCBI Gene Id: 43
• Protein Name: Acetylcholinesterase
• Description of Target: Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood gro
• Uniprot ID: P22303
• Protein Accession #: NP_056646
• Nucleotide Accession #: NM_015831
• Protein Size (# AA): 617
• Molecular Weight: 61kDa
• Protein Interactions: COL1A1; PRIMA1; COLQ; HAND1; EIF2D; LAMA1; LAMB1; COL4A1; APP; ACHE;