ACE2 Antibody - C-terminal region (ARP86964_P050)

Catalog No: ARP86964_P050

Host: Rabbit
Target Name: ACE2
Sample Tissue: Human COLO205 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACE2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYAS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACE2 (ARP86964_P050) antibody is Catalog # AAP86964

Target Info

• Gene Symbol: ACE2
• Gene Full Name: angiotensin I converting enzyme 2
• Alias Symbols: ACEH
• NCBI Gene Id: 59272
• Protein Name: Angiotensin-converting enzyme 2
• Description of Target: The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63.
• Uniprot ID: Q9BYF1
• Protein Accession #: NP_068576.1
• Nucleotide Accession #: NM_021804.2
• Protein Size (# AA): 805
• Molecular Weight: 88 kDa