SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP37696_T100
Price: $0.00
SKU
ARP37696_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ACCN5 Antibody - middle region (ARP37696_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ASIC5 (ARP37696_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ACCN5
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHorse: 79%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD
Concentration1.0 mg/ml
Blocking PeptideFor anti-ASIC5 (ARP37696_T100) antibody is Catalog # AAP37696 (Previous Catalog # AAPP09030)
ReferenceSchaefer,L., et al., (2000) FEBS Lett. 471 (2-3), 205-210
Gene SymbolASIC5
Gene Full NameAcid-sensing (proton-gated) ion channel family member 5
Alias SymbolsINAC, ACCN5, HINAC
NCBI Gene Id51802
Protein NameAcid-sensing ion channel 5
Description of TargetACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.
Uniprot IDQ9NY37
Protein Accession #NP_059115
Nucleotide Accession #NM_017419
Protein Size (# AA)505
Molecular Weight56kDa
  1. What is the species homology for "ACCN5 Antibody - middle region (ARP37696_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Horse".

  2. How long will it take to receive "ACCN5 Antibody - middle region (ARP37696_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACCN5 Antibody - middle region (ARP37696_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACCN5 Antibody - middle region (ARP37696_T100)"?

    This target may also be called "INAC, ACCN5, HINAC" in publications.

  5. What is the shipping cost for "ACCN5 Antibody - middle region (ARP37696_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACCN5 Antibody - middle region (ARP37696_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACCN5 Antibody - middle region (ARP37696_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACCN5 Antibody - middle region (ARP37696_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ASIC5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ASIC5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ASIC5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ASIC5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ASIC5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ASIC5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACCN5 Antibody - middle region (ARP37696_T100)
Your Rating