ACADL Antibody - N-terminal region (ARP33855_P050)

Catalog No: ARP33855_P050

WB Suggested Anti-ACADL Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACADL
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 85%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACADL (ARP33855_P050) antibody is Catalog # AAP33855 (Previous Catalog # AAPP04926)
• Reference: Lea,W., Biochim. Biophys. Acta 1485 (2-3), 121-128 (2000)

Target Info

• Gene Symbol: ACADL
• Gene Full Name: Acyl-CoA dehydrogenase, long chain
• Alias Symbols: LCAD, ACAD4
• NCBI Gene Id: 33
• Protein Name: Long-chain specific acyl-CoA dehydrogenase, mitochondrial
• Description of Target: ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in ACADL gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
• Uniprot ID: P28330
• Protein Accession #: NP_001599
• Nucleotide Accession #: NM_001608
• Protein Size (# AA): 430
• Molecular Weight: 44kDa
• Protein Interactions: Htt; UBC;