Size:100 ul
$319.00
In Stock
SKU
ARP33856_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33856_P050-FITC Conjugated

ARP33856_P050-HRP Conjugated

ARP33856_P050-Biotin Conjugated

ACADL Antibody - middle region (ARP33856_P050)

Catalog#: ARP33856_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-72425 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACADL
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data Anti-ACADL (ARP33856_P050)
Peptide Sequence Synthetic peptide located within the following region: LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ACADL (ARP33856_P050) antibody is Catalog # AAP33856 (Previous Catalog # AAPP04927)
Datasheets/Manuals Printable datasheet for anti-ACADL (ARP33856_P050) antibody
Target Reference Lea,W., Biochim. Biophys. Acta 1485 (2-3), 121-128 (2000)
Publications

Mells, J. E. et al. Glp-1 analog, liraglutide, ameliorates hepatic steatosis and cardiac hypertrophy in C57BL/6J mice fed a Western diet. Am. J. Physiol. Gastrointest. Liver Physiol. 302, G225-35 (2012). WB, Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22038829

Gene Symbol ACADL
Official Gene Full Name Acyl-CoA dehydrogenase, long chain
Alias Symbols ACAD4, LCAD
NCBI Gene Id 33
Protein Name Long-chain specific acyl-CoA dehydrogenase, mitochondrial
Description of Target ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
Swissprot Id P28330
Protein Accession # NP_001599
Nucleotide Accession # NM_001608
Protein Size (# AA) 430
Molecular Weight 44kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACADL.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACADL.
Protein Interactions Htt; UBC;
  1. What is the species homology for "ACADL Antibody - middle region (ARP33856_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ACADL Antibody - middle region (ARP33856_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACADL Antibody - middle region (ARP33856_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACADL Antibody - middle region (ARP33856_P050)"?

    This target may also be called "ACAD4, LCAD" in publications.

  5. What is the shipping cost for "ACADL Antibody - middle region (ARP33856_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACADL Antibody - middle region (ARP33856_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACADL Antibody - middle region (ARP33856_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACADL Antibody - middle region (ARP33856_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ACADL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACADL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACADL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACADL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACADL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACADL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACADL Antibody - middle region (ARP33856_P050)
Your Rating
We found other products you might like!