- Tested Species Reactivity:
- Human
- Predicted Species Reactivity:
- Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- ACADL
- Official Gene Full Name:
- Acyl-CoA dehydrogenase, long chain
- NCBI Gene Id:
- 33
- Protein Name:
- Long-chain specific acyl-CoA dehydrogenase, mitochondrial
- Swissprot Id:
- P28330
- Protein Accession #:
- NP_001599
- Nucleotide Accession #:
- NM_001608
- Alias Symbols:
- ACAD4, LCAD
- Replacement Item:
- This antibody may replace item sc-72425 from Santa Cruz Biotechnology.
- Description of Target:
- ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
- Protein Size (# AA):
- 430
- Molecular Weight:
- 44kDa
- Purification:
- Affinity Purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express ACADL.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express ACADL.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the middle region of human ACADL
- Predicted Homology Based on Immunogen Sequence:
- Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
- Complete computational species homology data:
- Anti-ACADL (ARP33856_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- Htt; UBC;
- Blocking Peptide:
- For anti-ACADL (ARP33856_P050) antibody is Catalog # AAP33856 (Previous Catalog # AAPP04927)
- Datasheets/Manuals:
- Printable datasheet for anti-ACADL (ARP33856_P050) antibody
- Target Reference:
- Lea,W., Biochim. Biophys. Acta 1485 (2-3), 121-128 (2000)
- Publications:
Mells, J. E. et al. Glp-1 analog, liraglutide, ameliorates hepatic steatosis and cardiac hypertrophy in C57BL/6J mice fed a Western diet. Am. J. Physiol. Gastrointest. Liver Physiol. 302, G225-35 (2012). WB, Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22038829
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
