ACADL Antibody - middle region (ARP33856_P050)

Catalog#: ARP33856_P050

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Gene Symbol: ACADL
• Official Gene Full Name: Acyl-CoA dehydrogenase, long chain
• NCBI Gene Id: 33
• Protein Name: Long-chain specific acyl-CoA dehydrogenase, mitochondrial
• Swissprot Id: P28330
• Protein Accession #: NP_001599
• Nucleotide Accession #: NM_001608
• Alias Symbols: ACAD4, LCAD
• Replacement Item: This antibody may replace item sc-72425 from Santa Cruz Biotechnology.
• Description of Target: ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
• Protein Size (# AA): 430
• Molecular Weight: 44kDa
• Purification: Affinity Purified
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express ACADL.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACADL
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: Htt; UBC;
• Blocking Peptide: For anti-ACADL (ARP33856_P050) antibody is Catalog # AAP33856 (Previous Catalog # AAPP04927)
• Target Reference: Lea,W., Biochim. Biophys. Acta 1485 (2-3), 121-128 (2000)
• Publications:

  Mells, J. E. et al. Glp-1 analog, liraglutide, ameliorates hepatic steatosis and cardiac hypertrophy in C57BL/6J mice fed a Western diet. Am. J. Physiol. Gastrointest. Liver Physiol. 302, G225-35 (2012). WB, Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22038829

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: ACADL antibody tested with Human Placenta Tissue (ARP33856_P050)