Search Antibody, Protein, and ELISA Kit Solutions

ACADL Antibody - middle region (ARP33856_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33856_P050-FITC Conjugated

ARP33856_P050-HRP Conjugated

ARP33856_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ACADL
Official Gene Full Name:
Acyl-CoA dehydrogenase, long chain
NCBI Gene Id:
33
Protein Name:
Long-chain specific acyl-CoA dehydrogenase, mitochondrial
Swissprot Id:
P28330
Protein Accession #:
NP_001599
Nucleotide Accession #:
NM_001608
Alias Symbols:
ACAD4, LCAD
Replacement Item:
This antibody may replace item sc-72425 from Santa Cruz Biotechnology.
Description of Target:
ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
Protein Size (# AA):
430
Molecular Weight:
44kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACADL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACADL.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ACADL
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-ACADL (ARP33856_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Htt; UBC;
Blocking Peptide:
For anti-ACADL (ARP33856_P050) antibody is Catalog # AAP33856 (Previous Catalog # AAPP04927)
Datasheets/Manuals:
Printable datasheet for anti-ACADL (ARP33856_P050) antibody
Target Reference:
Lea,W., Biochim. Biophys. Acta 1485 (2-3), 121-128 (2000)
Publications:

Mells, J. E. et al. Glp-1 analog, liraglutide, ameliorates hepatic steatosis and cardiac hypertrophy in C57BL/6J mice fed a Western diet. Am. J. Physiol. Gastrointest. Liver Physiol. 302, G225-35 (2012). WB, Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22038829

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...