ACADL Antibody - C-terminal region (ARP90258_P050)

Catalog No: ARP90258_P050

Host: Rabbit
Target Name: ACADL
Sample Tissue: Mouse Small Intestine lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse ACADL
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: SVAYECVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKELIARQIV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACADL (ARP90258_P050) antibody is Catalog # AAP90258

Target Info

• Gene Symbol: ACADL
• Gene Full Name: acyl-Coenzyme A dehydrogenase, long-chain
• Alias Symbols: LC, LCAD, C79855, AA960361, AU018452
• NCBI Gene Id: 11363
• Protein Name: long-chain specific acyl-CoA dehydrogenase, mitochondrial
• Description of Target: This gene encodes a homotetrameric mitochondrial flavoprotein and is a member of the acyl-CoA dehydrogenase family. Members of this family catalyze the first step of fatty acid beta-oxidation, forming a C2-C3 trans-double bond in a FAD-dependent reaction. As beta-oxidation cycles through its four steps, each member of the acyl-CoA dehydrogenase family works at an optimum fatty acid chain-length. This enzyme has its optimum length between C12- and C16-acylCoA. In mice, deficiency of this gene can cause sudden death, cardiomyopathy as well as fasting and cold intolerance.
• Uniprot ID: P51174
• Protein Accession #: NP_031407.2
• Nucleotide Accession #: NM_007381.4
• Protein Size (# AA): 430
• Molecular Weight: 47 kDa