Catalog No: OPCA335771
Price: $0.00
SKU
OPCA335771
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ AC-LEF10 Recombinant Protein (AcMNPV) (OPCA335771)
| Datasheets/Manuals | Printable datasheet for OPCA335771 |
|---|
| Predicted Species Reactivity | AcMNPV |
|---|---|
| Product Format | Liquid |
| Application | WB, ELISA |
| Additional Information | For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request. |
| Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MTNVWFATDVNLINCVLKDNLFLIDNNYIILNVFDQETDQVRPLCLGEINALQTDAAAQADAMLDTSSTSELQSNAST |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Protein Range | 28491 |
| Alias Symbols | AcOrf-53a |
|---|---|
| NCBI Gene Id | 1403886 |
| Protein Name | LEF10 |
| Uniprot ID | Q9YKK9 |
| Protein Size (# AA) | 78 |
Write Your Own Review