ABP1 Recombinant Protein (Maize) (OPCA01014)

Catalog No: OPCA01014

Product Info

• Predicted Species Reactivity: Zea mays
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : His tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL
• Protein Sequence: SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 39-201 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Molecular analysis of three maize 22KDA auxin-binding protein genes -- transient promoter expression and regulatory regions.Schwob E., Choi S.-Y., Simmons C., Migliaccio F., Ilag L., Hesse T., Palme K., Soell D.Plant J. 4:423-432(1993)
• Gene Symbol: ABP1
• Alias Symbols: ERABP1.
• Protein Name: Auxin-binding protein 1
• Description of Target: Receptor for the plant hormone auxin.
• Uniprot ID: P13689
• Protein Size (# AA): Recombinant
• Molecular Weight: 22.4 kDa