- Gene Symbol:
- AOC1
- NCBI Gene Id:
- 26
- Official Gene Full Name:
- Amiloride binding protein 1 (amine oxidase (copper-containing))
- Protein Name:
- Amiloride-sensitive amine oxidase [copper-containing]
- Swissprot Id:
- P19801
- Protein Accession #:
- NP_001082
- Nucleotide Accession #:
- NM_001091
- Alias Symbols:
- ABP, AOC1, DAO, DAO1, KAO, ABP1
- Description of Target:
- ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.
- Protein Size (# AA):
- 751
- Molecular Weight:
- 83kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express ABP1.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express ABP1.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C terminal region of human ABP1
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
- Complete computational species homology data:
- Anti-ABP1 (ARP41908_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- DAO; DNM2; FGD1;
- Blocking Peptide:
- For anti-AOC1 (ARP41908_P050) antibody is Catalog # AAP41908 (Previous Catalog # AAPP12525)
- Datasheets/Manuals:
- Printable datasheet for anti-AOC1 (ARP41908_P050) antibody
- Additional Information:
- IHC Information: HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 8%.
- Target Reference:
- Boomsma,F., (2005) Diabetologia 48 (5), 1002-1007
- Publications:
Liang, X.-H. et al. Estrogen regulates amiloride-binding protein 1 through CCAAT/enhancer-binding protein-beta in mouse uterus during embryo implantation and decidualization. Endocrinology 151, 5007-16 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20668027
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
