Search Antibody, Protein, and ELISA Kit Solutions

ABP1 Antibody - C-terminal region (ARP41908_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41908_P050-FITC Conjugated

ARP41908_P050-HRP Conjugated

ARP41908_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 8%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Amiloride binding protein 1 (amine oxidase (copper-containing))
NCBI Gene Id:
Protein Name:
Amiloride-sensitive amine oxidase [copper-containing]
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ABP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ABP1.
The immunogen is a synthetic peptide directed towards the C terminal region of human ABP1
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-ABP1 (ARP41908_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-AOC1 (ARP41908_P050) antibody is Catalog # AAP41908 (Previous Catalog # AAPP12525)
Printable datasheet for anti-AOC1 (ARP41908_P050) antibody
Target Reference:
Boomsma,F., (2005) Diabetologia 48 (5), 1002-1007

Liang, X.-H. et al. Estrogen regulates amiloride-binding protein 1 through CCAAT/enhancer-binding protein-beta in mouse uterus during embryo implantation and decidualization. Endocrinology 151, 5007-16 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20668027

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...