Size:100 ul
$319.00
In Stock
SKU
ARP41908_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41908_P050-FITC Conjugated

ARP41908_P050-HRP Conjugated

ARP41908_P050-Biotin Conjugated

ABP1 Antibody - C-terminal region (ARP41908_P050)

Catalog#: ARP41908_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 8%.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ABP1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-ABP1 (ARP41908_P050)
Peptide Sequence Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-AOC1 (ARP41908_P050) antibody is Catalog # AAP41908 (Previous Catalog # AAPP12525)
Datasheets/Manuals Printable datasheet for anti-AOC1 (ARP41908_P050) antibody
Target Reference Boomsma,F., (2005) Diabetologia 48 (5), 1002-1007
Publications

Liang, X.-H. et al. Estrogen regulates amiloride-binding protein 1 through CCAAT/enhancer-binding protein-beta in mouse uterus during embryo implantation and decidualization. Endocrinology 151, 5007-16 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20668027

Gene Symbol AOC1
Official Gene Full Name Amiloride binding protein 1 (amine oxidase (copper-containing))
Alias Symbols ABP, AOC1, DAO, DAO1, KAO, ABP1
NCBI Gene Id 26
Protein Name Amiloride-sensitive amine oxidase [copper-containing]
Description of Target ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.
Swissprot Id P19801
Protein Accession # NP_001082
Nucleotide Accession # NM_001091
Protein Size (# AA) 751
Molecular Weight 83kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ABP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ABP1.
Protein Interactions DAO; DNM2; FGD1;
  1. What is the species homology for "ABP1 Antibody - C-terminal region (ARP41908_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ABP1 Antibody - C-terminal region (ARP41908_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ABP1 Antibody - C-terminal region (ARP41908_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ABP1 Antibody - C-terminal region (ARP41908_P050)"?

    This target may also be called "ABP, AOC1, DAO, DAO1, KAO, ABP1" in publications.

  5. What is the shipping cost for "ABP1 Antibody - C-terminal region (ARP41908_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ABP1 Antibody - C-terminal region (ARP41908_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ABP1 Antibody - C-terminal region (ARP41908_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "83kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ABP1 Antibody - C-terminal region (ARP41908_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "AOC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AOC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AOC1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AOC1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AOC1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AOC1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ABP1 Antibody - C-terminal region (ARP41908_P050)
Your Rating
We found other products you might like!