- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-ABI1 (ARP63430_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: IEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNRVTGLFPG |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-ABI1 (ARP63430_P050) antibody is Catalog # AAP63430 |
Sample Type Confirmation | ABI1 is strongly supported by BioGPS gene expression data to be expressed in 721_B |
Gene Symbol | ABI1 |
---|---|
Gene Full Name | Abl-interactor 1 |
Alias Symbols | E3B1, ABI-1, ABLBP4, NAP1BP, SSH3BP, SSH3BP1 |
NCBI Gene Id | 10006 |
Protein Name | Abl-interactor 1 variant 72 EMBL ACJ12785.1 |
Description of Target | This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. |
Uniprot ID | B6VEX5 |
Protein Accession # | NP_001171595 |
Nucleotide Accession # | NM_001178124 |
Protein Size (# AA) | 388 |
Molecular Weight | 42kDa |
Protein Interactions | ABL1; UBC; PRPF40A; TCERG1; GAS7; APBB1; SRRM1; PRKAA1; PIK3R1; CDC123; CTTN; NCK2; NCK1; CBL; CACNA1A; RYK; EPS8L1; ENAH; MINK1; EVL; NIN; CYFIP2; HSPA8; WASF2; WASF1; PAK2; NCKAP1; ABI1; VASP; SOS2; EPS8; NCF1; SPTA1; SPTAN1; SOS1; NEB; EPS8L3; EPS8L2; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ABI1 Antibody - C-terminal region (ARP63430_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "ABI1 Antibody - C-terminal region (ARP63430_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "ABI1 Antibody - C-terminal region (ARP63430_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ABI1 Antibody - C-terminal region (ARP63430_P050)"?
This target may also be called "E3B1, ABI-1, ABLBP4, NAP1BP, SSH3BP, SSH3BP1" in publications.
-
What is the shipping cost for "ABI1 Antibody - C-terminal region (ARP63430_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ABI1 Antibody - C-terminal region (ARP63430_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ABI1 Antibody - C-terminal region (ARP63430_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "42kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ABI1 Antibody - C-terminal region (ARP63430_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ABI1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ABI1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ABI1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ABI1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ABI1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ABI1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.