Search Antibody, Protein, and ELISA Kit Solutions

ABHD14A Antibody - middle region (ARP67925_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP67925_P050-FITC Conjugated

ARP67925_P050-HRP Conjugated

ARP67925_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Protein Name:
Alpha/beta hydrolase domain-containing protein 14A
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-140768 from Santa Cruz Biotechnology.
Description of Target:
ABHD14A play a possible role in granule neuron development.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ABHD14A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ABHD14A.
The immunogen is a synthetic peptide directed towards the middle region of Human ABHD14A
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 86%
Peptide Sequence:
Synthetic peptide located within the following region: DLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ABHD14A (ARP67925_P050) antibody is Catalog # AAP67925
Printable datasheet for anti-ABHD14A (ARP67925_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...