Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP67925_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP67925_P050-FITC Conjugated

ARP67925_P050-HRP Conjugated

ARP67925_P050-Biotin Conjugated

ABHD14A Antibody - middle region (ARP67925_P050)

Catalog#: ARP67925_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-140768 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human ABHD14A
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 86%
Peptide Sequence Synthetic peptide located within the following region: DLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ABHD14A (ARP67925_P050) antibody is Catalog # AAP67925
Datasheets/Manuals Printable datasheet for anti-ABHD14A (ARP67925_P050) antibody
Gene Symbol ABHD14A
Alias Symbols DORZ1
NCBI Gene Id 25864
Protein Name Alpha/beta hydrolase domain-containing protein 14A
Description of Target ABHD14A play a possible role in granule neuron development.
Swissprot Id Q9BUJ0
Protein Accession # NP_056222
Nucleotide Accession # NM_015407
Protein Size (# AA) 271
Molecular Weight 30kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ABHD14A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ABHD14A.
Protein Interactions GINS3; BZW2; RAP1GDS1; PPP5C; CTSA; PFAS; PAFAH1B2; EIF6; HSPA9; GSS; ECHS1;
Write Your Own Review
You're reviewing:ABHD14A Antibody - middle region (ARP67925_P050)
Your Rating