Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ABHD1 antibody - middle region (ARP50088_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP50088_P050-FITC Conjugated

ARP50088_P050-HRP Conjugated

ARP50088_P050-Biotin Conjugated

Gene Symbol:
ABHD1
NCBI Gene Id:
84696
Official Gene Full Name:
Abhydrolase domain containing 1
Protein Name:
Abhydrolase domain-containing protein 1
Swissprot Id:
Q96SE0
Protein Accession #:
NP_115993
Nucleotide Accession #:
NM_032604
Alias Symbols:
FLJ36128, LABH1
Replacement Item:
This antibody may replace item sc-167034 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the AB hydrolase superfamily and encodes a protein with an alpha/beta hydrolase fold. This domain is common to a number of hydrolytic enzymes of widely differing phylogenetic origins and catalytic functions.
Protein Size (# AA):
405
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ABHD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ABHD1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ABHD1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-ABHD1 (ARP50088_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CCDC155;
Blocking Peptide:
For anti-ABHD1 (ARP50088_P050) antibody is Catalog # AAP50088 (Previous Catalog # AAPP44757)
Datasheets/Manuals:
Printable datasheet for anti-ABHD1 (ARP50088_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...