Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ABCG5 antibody - middle region (ARP43703_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP43703_P050-FITC Conjugated

ARP43703_P050-HRP Conjugated

ARP43703_P050-Biotin Conjugated

Gene Symbol:
ABCG5
NCBI Gene Id:
64240
Official Gene Full Name:
ATP-binding cassette, sub-family G (WHITE), member 5
Protein Name:
ATP-binding cassette sub-family G member 5
Swissprot Id:
Q9H222
Protein Accession #:
NP_071881
Nucleotide Accession #:
NM_022436
Alias Symbols:
STSL
Replacement Item:
This antibody may replace item sc-18203 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene may contribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia.
Protein Size (# AA):
651
Molecular Weight:
72kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ABCG5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ABCG5.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ABCG5
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Complete computational species homology data:
Anti-ABCG5 (ARP43703_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Dlg4; ABCG8;
Blocking Peptide:
For anti-ABCG5 (ARP43703_P050) antibody is Catalog # AAP43703 (Previous Catalog # AAPP11692)
Datasheets/Manuals:
Printable datasheet for anti-ABCG5 (ARP43703_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...