Search Antibody, Protein, and ELISA Kit Solutions

ABCG2 Antibody - N-terminal region (ARP43649_T100)

  • Catalog#: ARP43649_T100
  • Inquire
Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
Request Bulk Order Quote

Conjugation Options

ARP43649_T100-FITC Conjugated

ARP43649_T100-HRP Conjugated

ARP43649_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ATP-binding cassette, sub-family G (WHITE), member 2
NCBI Gene Id:
Protein Name:
ATP-binding cassette sub-family G member 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ABC15, ABCP, BCRP, BCRP1, BMDP, CDw338, EST157481, MGC102821, MRX, MXR, MXR1, CD338
Description of Target:
ABCG2 is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ABCG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ABCG2.
The immunogen is a synthetic peptide directed towards the N terminal region of human ABCG2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 86%; Zebrafish: 92%
Complete computational species homology data:
Anti-ABCG2 (ARP43649_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; Trim69;
Blocking Peptide:
For anti-ABCG2 (ARP43649_T100) antibody is Catalog # AAP43649 (Previous Catalog # AAPP11638)
Printable datasheet for anti-ABCG2 (ARP43649_T100) antibody
Sample Type Confirmation:

ABCG2 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Gupta,N., (2006) Biochem. Biophys. Res. Commun. 343 (2), 571-577

Kawase, A. et al. Distinct alterations in ATP-binding cassette transporter expression in liver, kidney, small intestine, and brain in adjuvant-induced arthritic rats. J. Pharm. Sci. 103, 2556-64 (2014). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish 24912442

Naglah, AM; Shinwari, Z; Bhat, MA; Al-Tahhan, M; Al-Omar, MA; Al-Dhfyan, A; Targeting leukemic side population cells by isatin derivatives of nicotinic acid amide. 30, 353-63 (2016). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish 27358121

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...