Size:100 ul
$229.00
Discontinued
SKU
ARP43649_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43649_T100-FITC Conjugated

ARP43649_T100-HRP Conjugated

ARP43649_T100-Biotin Conjugated

ABCG2 Antibody - N-terminal region (ARP43649_T100)

Catalog#: ARP43649_T100
Inquire
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ABCG2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 86%; Zebrafish: 92%
Complete computational species homology data Anti-ABCG2 (ARP43649_T100)
Peptide Sequence Synthetic peptide located within the following region: SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ABCG2 (ARP43649_T100) antibody is Catalog # AAP43649 (Previous Catalog # AAPP11638)
Datasheets/Manuals Printable datasheet for anti-ABCG2 (ARP43649_T100) antibody
Sample Type Confirmation

ABCG2 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Gupta,N., (2006) Biochem. Biophys. Res. Commun. 343 (2), 571-577
Publications

Kawase, A. et al. Distinct alterations in ATP-binding cassette transporter expression in liver, kidney, small intestine, and brain in adjuvant-induced arthritic rats. J. Pharm. Sci. 103, 2556-64 (2014). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish 24912442

Naglah, AM; Shinwari, Z; Bhat, MA; Al-Tahhan, M; Al-Omar, MA; Al-Dhfyan, A; Targeting leukemic side population cells by isatin derivatives of nicotinic acid amide. 30, 353-63 (2016). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish 27358121

Gene Symbol ABCG2
Official Gene Full Name ATP-binding cassette, sub-family G (WHITE), member 2
Alias Symbols ABC15, ABCP, BCRP, BCRP1, BMDP, CDw338, EST157481, MGC102821, MRX, MXR, MXR1, CD338
NCBI Gene Id 9429
Protein Name ATP-binding cassette sub-family G member 2
Description of Target ABCG2 is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.
Swissprot Id Q9UNQ0
Protein Accession # NP_004818
Nucleotide Accession # NM_004827
Protein Size (# AA) 655
Molecular Weight 72kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ABCG2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ABCG2.
Protein Interactions UBC; Trim69;
  1. What is the species homology for "ABCG2 Antibody - N-terminal region (ARP43649_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish".

  2. How long will it take to receive "ABCG2 Antibody - N-terminal region (ARP43649_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ABCG2 Antibody - N-terminal region (ARP43649_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ABCG2 Antibody - N-terminal region (ARP43649_T100)"?

    This target may also be called "ABC15, ABCP, BCRP, BCRP1, BMDP, CDw338, EST157481, MGC102821, MRX, MXR, MXR1, CD338" in publications.

  5. What is the shipping cost for "ABCG2 Antibody - N-terminal region (ARP43649_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ABCG2 Antibody - N-terminal region (ARP43649_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ABCG2 Antibody - N-terminal region (ARP43649_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "72kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ABCG2 Antibody - N-terminal region (ARP43649_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ABCG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ABCG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ABCG2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ABCG2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ABCG2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ABCG2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ABCG2 Antibody - N-terminal region (ARP43649_T100)
Your Rating
We found other products you might like!