Size:100 ul
$229.00
In stock
SKU
ARP43649_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43649_T100-FITC Conjugated

ARP43649_T100-HRP Conjugated

ARP43649_T100-Biotin Conjugated

ABCG2 Antibody - N-terminal region (ARP43649_T100)

Catalog#: ARP43649_T100
Inquire
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ABCG2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 86%; Zebrafish: 92%
Complete computational species homology dataAnti-ABCG2 (ARP43649_T100)
Peptide SequenceSynthetic peptide located within the following region: SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ABCG2 (ARP43649_T100) antibody is Catalog # AAP43649 (Previous Catalog # AAPP11638)
Datasheets/ManualsPrintable datasheet for anti-ABCG2 (ARP43649_T100) antibody
Sample Type Confirmation

ABCG2 is supported by BioGPS gene expression data to be expressed in HepG2

Target ReferenceGupta,N., (2006) Biochem. Biophys. Res. Commun. 343 (2), 571-577
Publications

Kawase, A. et al. Distinct alterations in ATP-binding cassette transporter expression in liver, kidney, small intestine, and brain in adjuvant-induced arthritic rats. J. Pharm. Sci. 103, 2556-64 (2014). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish 24912442

Naglah, AM; Shinwari, Z; Bhat, MA; Al-Tahhan, M; Al-Omar, MA; Al-Dhfyan, A; Targeting leukemic side population cells by isatin derivatives of nicotinic acid amide. 30, 353-63 (2016). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish 27358121

Gene SymbolABCG2
Official Gene Full NameATP-binding cassette, sub-family G (WHITE), member 2
Alias SymbolsABC15, ABCP, BCRP, BCRP1, BMDP, CDw338, EST157481, MGC102821, MRX, MXR, MXR1, CD338
NCBI Gene Id9429
Protein NameATP-binding cassette sub-family G member 2
Description of TargetABCG2 is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.
Swissprot IdQ9UNQ0
Protein Accession #NP_004818
Nucleotide Accession #NM_004827
Protein Size (# AA)655
Molecular Weight72kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ABCG2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ABCG2.
Protein InteractionsUBC; Trim69;
Write Your Own Review
You're reviewing:ABCG2 Antibody - N-terminal region (ARP43649_T100)
Your Rating
Aviva HIS tag Deal
Free Microscope
Aviva Tissue Tool
Aviva Live Chat