Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ABCC9 antibody - middle region (ARP43664_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP43664_P050-FITC Conjugated

ARP43664_P050-HRP Conjugated

ARP43664_P050-Biotin Conjugated

Gene Symbol:
ABCC9
NCBI Gene Id:
10060
Official Gene Full Name:
ATP-binding cassette, sub-family C (CFTR/MRP), member 9
Protein Name:
ATP-binding cassette sub-family C member 9
Swissprot Id:
O60706
Protein Accession #:
NP_005682
Nucleotide Accession #:
NM_005691
Alias Symbols:
ABC37, CMD1O, FLJ36852, SUR2, ATFB12
Replacement Item:
This antibody may replace item sc-28289 from Santa Cruz Biotechnology.
Description of Target:
ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion.
Protein Size (# AA):
1549
Molecular Weight:
174kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ABCC9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ABCC9.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ABCC9
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-ABCC9 (ARP43664_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EEF1G; KCNJ11; KCNJ8; STX1A; LDHA;
Blocking Peptide:
For anti-ABCC9 (ARP43664_P050) antibody is Catalog # AAP43664 (Previous Catalog # AAPP11653)
Datasheets/Manuals:
Printable datasheet for anti-ABCC9 (ARP43664_P050) antibody
Sample Type Confirmation:

ABCC9 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Burke,M.A., (2008) Circ. Res. 102 (2), 164-176
Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: ABCC9 antibody-middle region (ARP43664_P050) in SUR1 KO mouse ventricle lysate, WT mouse ventricle lysate, SUR1 overexpressing mouse ventricle lysate and cannine ventricle lysate using Western blot
Product Page for ABCC9 antibody-middle region (ARP43664_P050)

Researcher: Haixia Zhang
Application: Western blotting
Species + Tissue/Cell type: 1: 10ug SUR1 KO mouse ventricle lysate, 2: 10ug WT mouse ventricle lysate, 3: 0.1ug SUR1 overexpressing mouse ventricle lysate, 4: 10ug cannine ventricle lysate
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit HRP
Secondary antibody dilution: 1:2000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Fine
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4. Detected well on mouse samples but two week on dog sample. I may load more protein in the future experiment.
Would you use this antibody in future experiments? Yes.
Have you used another antibody which has worked in your application? Yes.
Do you believe the information about the reagent on Aviva's website is correct? Yes.
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, since it looks working, but I need to modify my protocol.
How did you store the antibody after re-suspension? At -20 degree C.
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Dog and mouse, hearts, 10 ug
How many different experimental trials were conducted using the antibody sample? 4
Primary antibody dilution and incubation time: 1:1000, 2h at RT.
Secondary antibody used and dilution and incubation time: 1:2000, 2h at RT.
What controls were used in your experiment (positive/negative)? SUR1 transgenic mice.
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...