ABCC9 Antibody - middle region (ARP43664_P050)

Catalog No: ARP43664_P050

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Lanes:
1: 10ug SUR1 KO mouse ventricle lysate, 2: 10ug WT mouse ventricle lysate, 3: 0.1ug SUR1 overexpressing mouse ventricle lysate, 4: 10ug cannine ventricle lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:2000
Gene Name:
ABCC9
Submitted by:
Haixia Zhang

Host: Rabbit
Target Name: ABCC9
Sample Tissue: Human PANC1
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ABCC9
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ABCC9 (ARP43664_P050) antibody is Catalog # AAP43664 (Previous Catalog # AAPP11653)
• Sample Type Confirmation:

  ABCC9 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Burke,M.A., (2008) Circ. Res. 102 (2), 164-176

Target Info

• Gene Symbol: ABCC9
• Gene Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 9
• Alias Symbols: SUR2, ABC37, CANTU, CMD1O, ATFB12
• NCBI Gene Id: 10060
• Protein Name: ATP-binding cassette sub-family C member 9
• Description of Target: ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion.
• Uniprot ID: O60706
• Protein Accession #: NP_005682
• Nucleotide Accession #: NM_005691
• Protein Size (# AA): 1549
• Molecular Weight: 174kDa
• Protein Interactions: EEF1G; KCNJ11; KCNJ8; STX1A; LDHA;