Search Antibody, Protein, and ELISA Kit Solutions

ABCC8 Antibody - N-terminal region (ARP43622_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43622_P050-FITC Conjugated

ARP43622_P050-HRP Conjugated

ARP43622_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Paraffin embedded small intestine tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ATP-binding cassette, sub-family C (CFTR/MRP), member 8
NCBI Gene Id:
Protein Name:
ATP-binding cassette sub-family C member 8
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-25683 from Santa Cruz Biotechnology.
Description of Target:
ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternative splicing of this gene has been observed; however, the transcript variants have not been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ABCC8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ABCC8.
The immunogen is a synthetic peptide directed towards the N terminal region of human ABCC8
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-ABCC8 (ARP43622_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ABCC8 (ARP43622_P050) antibody is Catalog # AAP43622 (Previous Catalog # AAPS15903)
Printable datasheet for anti-ABCC8 (ARP43622_P050) antibody
Target Reference:
Chiannilkulchai,N., (2008) J. Biol. Chem. 283 (14), 8778-8782

Němcová-Fürstová, V; Kopperová, D; Balušíková, K; Ehrlichová, M; Brynychová, V; Václavíková, R; Daniel, P; Souček, P; Kovář, J; Characterization of acquired paclitaxel resistance of breast cancer cells and involvement of ABC transporters. 310, 215-228 (2016). IHC, WB, Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 27664577

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

73/03/2018 17:52
  • Overall Experience:
  • Quality:
Human Pancreas in IHC
Submitted by: Dr. Aguilar-Bryan, Benaroya Research institution

How do Aviva’s reagents play a role in your experimental goals?
Help determine the localization of the target on tissue sections by IHC

How would you rate this antibody on a scale from 1-5 (5=best) and why?
4, antibody does not produce any background but the staining intensity is not strong

Have you used another antibody which has worked in your application?


Sample Description:  
Human pancreas

Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)?

Primary antibody dilution, incubation time and temperature: Dilution 5ug/ml, overnight at 4C

Secondary antibody dilution, incubation time and temperature: anti-rabbit biotinylated  1:300  1hr RT

Did you use an antigen retrieval method? no

What controls were used in your experiment? 
The pancreas is in itself a postive control tissue

Please include your detailed tissue preparation and staining procedure/protocol here: 
we followed the IHC protocol provided by Aviva
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...