Size:100 ul
$319.00
In stock
SKU
ARP43622_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43622_P050-FITC Conjugated

ARP43622_P050-HRP Conjugated

ARP43622_P050-Biotin Conjugated

ABCC8 Antibody - N-terminal region (ARP43622_P050)

Rating:
80% of 100
Catalog#: ARP43622_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded small intestine tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-25683 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ABCC8
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data Anti-ABCC8 (ARP43622_P050)
Peptide Sequence Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ABCC8 (ARP43622_P050) antibody is Catalog # AAP43622 (Previous Catalog # AAPS15903)
Datasheets/Manuals Printable datasheet for anti-ABCC8 (ARP43622_P050) antibody
Target Reference Chiannilkulchai,N., (2008) J. Biol. Chem. 283 (14), 8778-8782
Publications

Němcová-Fürstová, V; Kopperová, D; Balušíková, K; Ehrlichová, M; Brynychová, V; Václavíková, R; Daniel, P; Souček, P; Kovář, J; Characterization of acquired paclitaxel resistance of breast cancer cells and involvement of ABC transporters. 310, 215-228 (2016). IHC, WB, Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 27664577

Gene Symbol ABCC8
Official Gene Full Name ATP-binding cassette, sub-family C (CFTR/MRP), member 8
Alias Symbols ABC36, HHF1, HI, HRINS, MRP8, PHHI, SUR, SUR1, TNDM2, SUR1delta2
NCBI Gene Id 6833
Protein Name ATP-binding cassette sub-family C member 8
Description of Target ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternative splicing of this gene has been observed; however, the transcript variants have not been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q09428
Protein Accession # NP_000343
Nucleotide Accession # NM_000352
Protein Size (# AA) 1581
Molecular Weight 177kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ABCC8.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ABCC8.
Protein Interactions ENSA; KCNJ11; CRYBB1; KCNJ8; RAPGEF4;
Write Your Own Review
You're reviewing:ABCC8 Antibody - N-terminal region (ARP43622_P050)
Your Rating