Search Antibody, Protein, and ELISA Kit Solutions

ABCC3 Antibody - middle region (ARP43645_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43645_P050-FITC Conjugated

ARP43645_P050-HRP Conjugated

ARP43645_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ATP-binding cassette, sub-family C (CFTR/MRP), member 3
NCBI Gene Id:
Protein Name:
Canalicular multispecific organic anion transporter 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ABC31, EST90757, MLP2, MOAT-D, MRP3, cMOAT2
Replacement Item:
This antibody may replace item sc-28289 from Santa Cruz Biotechnology.
Description of Target:
ABCC3 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ABCC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ABCC3.
The immunogen is a synthetic peptide directed towards the middle region of human ABCC3
Predicted Homology Based on Immunogen Sequence:
Dog: 77%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Pig: 86%; Rat: 79%
Complete computational species homology data:
Anti-ABCC3 (ARP43645_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ABCC3 (ARP43645_P050) antibody is Catalog # AAP43645 (Previous Catalog # AAPP11634)
Printable datasheet for anti-ABCC3 (ARP43645_P050) antibody
Target Reference:
Muller,P., (2008) Leuk. Res. 32 (6), 919-929

Jeong, ES; Kim, G; Shin, HJ; Park, SM; Oh, JH; Kim, YB; Moon, KS; Choi, HK; Jeong, J; Shin, JG; Kim, DH; Increased serum bile acid concentration following low-dose chronic administration of thioacetamide in rats, as evidenced by metabolomic analysis. 288, 213-22 (2015). WB, Dog, Guinea Pig, Horse, Human, Pig, Rat 26222700

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...