ABCB4 Antibody (OABB01758)

Catalog No: OABB01758

Size:100UG

Anti-ABCB4 antibody, OABB01758, Western blotting
All lanes: Anti ABCB4 (OABB01758) at 0.5ug/ml
Lane 1: MCF-7 Whole Cell Lysate at 40ug
Lane 2: SW620 Whole Cell Lysate at 40ug
Lane 3: 22RV1 Whole Cell Lysate at 40ug
Lane 4: SKOV Whole Cell Lysate at 40ug
Predicted band size: 142KD
Observed band size: 142KD

Anti-ABCB4 antibody, OABB01758, IHC(P)
IHC(P): Human Mammary Cancer Tissue

Anti-ABCB4 antibody, OABB01758, IHC(P)
IHC(P): Mouse Intestine Tissue

Anti-ABCB4 antibody, OABB01758, IHC(P)
IHC(P): Rat Liver Tissue

Product Info

• Tested Species Reactivity: Human, Mouse, Rat
• Predicted Species Reactivity: Human|Mouse|Rat
• Product Format: Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Flow cytometry|Immunohistochemistry|Western blot
• Additional Information: Notes: WB: The detection limit for ABCB4 is approximately 0.1ng/lane under reducing conditions.
  Tested Species: In-house tested species with positive results.
  By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  
  Background: Adenosine triphosphate-binding cassette subfamily B, member 4 (ABCB4), also called MDR3, is a protein that in humans is encoded by the ABCB4 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. The ABCB4 gene contains 28 exons and 27 of these contain coding sequences for the two homologous halves of the protein that correlate with functional domains. ABCB4 gene mutations represent a genetic factor involved in this peculiar form of cholesterol gallstone disease in adults.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: E.coli-derived human ABCB4 recombinant protein (Position: A601-A720). Human ABCB4 shares 79% amino acid (aa) sequence identity with both mouse and rat ABCB4.
• Purification: Affinity Purified
• Peptide Sequence: E. coli derived human ABCB4 recombinant protein (Position: A601-A720): AGFEDGVIVEQGSHSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKVLKLNKTEWPYFVVGTVCAIA
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Human, Mouse, Rat
  Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human: By Heat
  Immunocytochemistry/Immunofluorescence: 2 ug/ml: Human
  Flow Cytometry: 1-3 ug/1x10^6 cells: Human
• Reference: 1. Lincke, C. R., Smit, J. J., van der Velde Koerts, T., Borst, P. Structure of the human MDR3 gene and physical mapping of the human MDR locus. J. Biol. Chem. 266: 5303-5310, 1991.
  2. Rosmorduc, O., Hermelin, B., Poupon, R. MDR3 gene defect in adults with symptomatic intrahepatic and gallbladder cholesterol cholelithiasis. Gastroenterology 120: 1459-1467, 2001.
  
• Storage Buffer: Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
• Description: Rabbit IgG polyclonal antibody for Phosphatidylcholine translocator ABCB4(ABCB4) detection. Tested with WB, IHC-P, ICC/IF, FCM in Human;Mouse;Rat.

Target Info

• Gene Symbol: ABCB4
• Gene Full Name: ATP binding cassette subfamily B member 4
• Alias Symbols: ABC21;ATP-binding cassette sub-family B member 4;ATP-binding cassette, sub-family B (MDR/TAP), member 4;GBD1;ICP3;MDR2;MDR2/3;MDR3;multidrug resistance protein 3;multiple drug resistance 3;PFIC-3;P-glycoprotein 3;P-glycoprotein-3/multiple drug resistance-3;PGY3;phosphatidylcholine translocator ABCB4.
• NCBI Gene Id: 5244
• Protein Name: Phosphatidylcholine translocator ABCB4
• Description of Target: Energy-dependent phospholipid efflux translocator that acts as a positive regulator of biliary lipid secretion. Functions as a floppase that translocates specifically phosphatidylcholine (PC) from the inner to the outer leaflet of the canalicular membrane bilayer into the canaliculi of hepatocytes. Translocation of PC makes the biliary phospholipids available for extraction into the canaliculi lumen by bile salt mixed micelles and therefore protects the biliary tree from the detergent activity of bile salts (PubMed:7957936, PubMed:8898203, PubMed:9366571, PubMed:17523162, PubMed:23468132, PubMed:24806754, PubMed:24723470, PubMed:24594635, PubMed:21820390). Plays a role in the recruitment of phosphatidylcholine (PC), phosphatidylethanolamine (PE) and sphingomyelin (SM) molecules to nonraft membranes and to fu rther enrichment of SM and cholesterol in raft membranes in hepatocytes (PubMed:23468132). Required for proper phospholipid bile formation (By similarity). Indirectly involved in cholesterol efflux activity from hepatocytes into the canalicular lumen in the presence of bile salts in an ATP-dependent manner (PubMed:24045840). Promotes biliary phospholipid secretion as canaliculi-containing vesicles from the canalicular plasma membrane (PubMed:9366571, PubMed:28012258). In cooperation with ATP8B1, functions to protect hepatocytes from the deleterious detergent activity of bile salts (PubMed:21820390). Does not confer multidrug resistance (By similarity).
• Uniprot ID: P21439
• Molecular Weight: 141523 MW