Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP43690_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43690_P050-FITC Conjugated

ARP43690_P050-HRP Conjugated

ARP43690_P050-Biotin Conjugated

Abca7 Antibody - middle region (ARP43690_P050)

Catalog#: ARP43690_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130576 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 100%
Complete computational species homology data Anti-Abca7 (ARP43690_P050)
Peptide Sequence Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Abca7 (ARP43690_P050) antibody is Catalog # AAP43690 (Previous Catalog # AAPP11679)
Datasheets/Manuals Printable datasheet for anti-Abca7 (ARP43690_P050) antibody
Publications

Bamji-Mirza, M; Li, Y; Najem, D; Liu, QY; Walker, D; Lue, LF; Stupak, J; Chan, K; Li, J; Ghani, M; Yang, Z; Rogaeva, E; Zhang, W; Genetic Variations in ABCA7 Can Increase Secreted Levels of Amyloid-b40 and Amyloid-b42 Peptides and ABCA7 Transcription in Cell Culture Models. 53, 875-92 (2016). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat 27314524

Gene Symbol Abca7
Official Gene Full Name ATP-binding cassette, sub-family A (ABC1), member 7
Alias Symbols ABCX, Abc51
NCBI Gene Id 27403
Protein Name ATP-binding cassette sub-family A member 7
Description of Target Abca7 plays a role in phagocytosis by macrophages of apoptotic cells.Abca7 binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. Abca7 may also mediate cholesterol efflux. Abca7 may regulate cellular ceramide homeostasis during keratinocytes differentiation.
Swissprot Id Q91V24
Protein Accession # NP_038878
Nucleotide Accession # NM_013850
Protein Size (# AA) 2159
Molecular Weight 237kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Abca7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Abca7.
Write Your Own Review
You're reviewing:Abca7 Antibody - middle region (ARP43690_P050)
Your Rating