Search Antibody, Protein, and ELISA Kit Solutions

Abca7 Antibody - middle region (ARP43690_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43690_P050-FITC Conjugated

ARP43690_P050-HRP Conjugated

ARP43690_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
ATP-binding cassette, sub-family A (ABC1), member 7
NCBI Gene Id:
Protein Name:
ATP-binding cassette sub-family A member 7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ABCX, Abc51
Replacement Item:
This antibody may replace item sc-130576 from Santa Cruz Biotechnology.
Description of Target:
Abca7 plays a role in phagocytosis by macrophages of apoptotic cells.Abca7 binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. Abca7 may also mediate cholesterol efflux. Abca7 may regulate cellular ceramide homeostasis during keratinocytes differentiation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Abca7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Abca7.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 100%
Complete computational species homology data:
Anti-Abca7 (ARP43690_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Abca7 (ARP43690_P050) antibody is Catalog # AAP43690 (Previous Catalog # AAPP11679)
Printable datasheet for anti-Abca7 (ARP43690_P050) antibody

Bamji-Mirza, M; Li, Y; Najem, D; Liu, QY; Walker, D; Lue, LF; Stupak, J; Chan, K; Li, J; Ghani, M; Yang, Z; Rogaeva, E; Zhang, W; Genetic Variations in ABCA7 Can Increase Secreted Levels of Amyloid-b40 and Amyloid-b42 Peptides and ABCA7 Transcription in Cell Culture Models. 53, 875-92 (2016). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat 27314524

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...