Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43690_P050-FITC Conjugated

ARP43690_P050-HRP Conjugated

ARP43690_P050-Biotin Conjugated

Abca7 Antibody - middle region (ARP43690_P050)

Catalog#: ARP43690_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130576 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 100%
Complete computational species homology data Anti-Abca7 (ARP43690_P050)
Peptide Sequence Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Abca7 (ARP43690_P050) antibody is Catalog # AAP43690 (Previous Catalog # AAPP11679)
Datasheets/Manuals Printable datasheet for anti-Abca7 (ARP43690_P050) antibody

Bamji-Mirza, M; Li, Y; Najem, D; Liu, QY; Walker, D; Lue, LF; Stupak, J; Chan, K; Li, J; Ghani, M; Yang, Z; Rogaeva, E; Zhang, W; Genetic Variations in ABCA7 Can Increase Secreted Levels of Amyloid-b40 and Amyloid-b42 Peptides and ABCA7 Transcription in Cell Culture Models. 53, 875-92 (2016). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat 27314524

Gene Symbol Abca7
Official Gene Full Name ATP-binding cassette, sub-family A (ABC1), member 7
Alias Symbols ABCX, Abc51
NCBI Gene Id 27403
Protein Name ATP-binding cassette sub-family A member 7
Description of Target Abca7 plays a role in phagocytosis by macrophages of apoptotic cells.Abca7 binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. Abca7 may also mediate cholesterol efflux. Abca7 may regulate cellular ceramide homeostasis during keratinocytes differentiation.
Swissprot Id Q91V24
Protein Accession # NP_038878
Nucleotide Accession # NM_013850
Protein Size (# AA) 2159
Molecular Weight 237kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Abca7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Abca7.
  1. What is the species homology for "Abca7 Antibody - middle region (ARP43690_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Rat".

  2. How long will it take to receive "Abca7 Antibody - middle region (ARP43690_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Abca7 Antibody - middle region (ARP43690_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "Abca7 Antibody - middle region (ARP43690_P050)"?

    This target may also be called "ABCX, Abc51" in publications.

  5. What is the shipping cost for "Abca7 Antibody - middle region (ARP43690_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Abca7 Antibody - middle region (ARP43690_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Abca7 Antibody - middle region (ARP43690_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "237kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Abca7 Antibody - middle region (ARP43690_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ABCA7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ABCA7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ABCA7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ABCA7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ABCA7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ABCA7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Abca7 Antibody - middle region (ARP43690_P050)
Your Rating
We found other products you might like!