ABCA10 Antibody (OAAL00513)

Catalog No: OAAL00513

Size:100UG

Detection limit for recombinant GST tagged ABCA10 is 1 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 8F4
• Isotype: IgG2b Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: ABCA10 (NP_525021, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCYL
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: ABCA10
• Gene Full Name: ATP binding cassette subfamily A member 10
• Alias Symbols: ATP-binding cassette A10;ATP-binding cassette sub-family A member 10;ATP-binding cassette, sub-family A (ABC1), member 10;EST698739.
• NCBI Gene Id: 10349
• Protein Name: ATP-binding cassette sub-family A member 10 [Homo sapiens]|Homo sapiens ATP binding cassette subfamily A member 10 (ABCA10), mRNA
• Description of Target: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_525021
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_080282