Search Antibody, Protein, and ELISA Kit Solutions

Abca1 antibody - middle region (ARP43660_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43660_P050-FITC Conjugated

ARP43660_P050-HRP Conjugated

ARP43660_P050-Biotin Conjugated

Gene Symbol:
Abca1
NCBI Gene Id:
11303
Official Gene Full Name:
ATP-binding cassette, sub-family A (ABC1), member 1
Protein Name:
ATP-binding cassette sub-family A member 1
Swissprot Id:
B1AWZ8
Protein Accession #:
NP_038482
Nucleotide Accession #:
NM_013454
Alias Symbols:
Abc1
Replacement Item:
This antibody may replace item sc-20794 from Santa Cruz Biotechnology.
Description of Target:
Abca1 is a cAMP-dependent and sulfonylurea-sensitive anion transporter. Abca1 is a key gatekeeper influencing intracellular cholesterol transport.
Protein Size (# AA):
2261
Molecular Weight:
254kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Abca1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Abca1.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%
Complete computational species homology data:
Anti-Abca1 (ARP43660_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Sptlc1; Ubc;
Blocking Peptide:
For anti-Abca1 (ARP43660_P050) antibody is Catalog # AAP43660 (Previous Catalog # AAPP11649)
Datasheets/Manuals:
Printable datasheet for anti-Abca1 (ARP43660_P050) antibody
Publications:

Fu, Y. et al. ABCA12 Regulates ABCA1-Dependent Cholesterol Efflux from Macrophages and the Development of Atherosclerosis. Cell Metab. 18, 225-38 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23931754

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...