Search Antibody, Protein, and ELISA Kit Solutions

Abca1 Antibody - middle region (ARP43660_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43660_P050-FITC Conjugated

ARP43660_P050-HRP Conjugated

ARP43660_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
ATP-binding cassette, sub-family A (ABC1), member 1
NCBI Gene Id:
Protein Name:
ATP-binding cassette sub-family A member 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-20794 from Santa Cruz Biotechnology.
Description of Target:
Abca1 is a cAMP-dependent and sulfonylurea-sensitive anion transporter. Abca1 is a key gatekeeper influencing intracellular cholesterol transport.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Abca1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Abca1.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%
Complete computational species homology data:
Anti-Abca1 (ARP43660_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Sptlc1; Ubc;
Blocking Peptide:
For anti-Abca1 (ARP43660_P050) antibody is Catalog # AAP43660 (Previous Catalog # AAPP11649)
Printable datasheet for anti-Abca1 (ARP43660_P050) antibody

Fu, Y. et al. ABCA12 Regulates ABCA1-Dependent Cholesterol Efflux from Macrophages and the Development of Atherosclerosis. Cell Metab. 18, 225-38 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23931754

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

121/05/2019 18:09
  • Overall Experience:
  • Quality:
Great antibody

Great antibody, works well in western blot analysis on bovine endothelial cells. 

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...