Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP43660_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43660_P050-FITC Conjugated

ARP43660_P050-HRP Conjugated

ARP43660_P050-Biotin Conjugated

Abca1 Antibody - middle region (ARP43660_P050)

Rating:
100% of 100
Catalog#: ARP43660_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-20794 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%
Complete computational species homology data Anti-Abca1 (ARP43660_P050)
Peptide Sequence Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Abca1 (ARP43660_P050) antibody is Catalog # AAP43660 (Previous Catalog # AAPP11649)
Datasheets/Manuals Printable datasheet for anti-Abca1 (ARP43660_P050) antibody
Publications

Fu, Y. et al. ABCA12 Regulates ABCA1-Dependent Cholesterol Efflux from Macrophages and the Development of Atherosclerosis. Cell Metab. 18, 225-38 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23931754

Gene Symbol Abca1
Official Gene Full Name ATP-binding cassette, sub-family A (ABC1), member 1
Alias Symbols Abc1
NCBI Gene Id 11303
Protein Name ATP-binding cassette sub-family A member 1
Description of Target Abca1 is a cAMP-dependent and sulfonylurea-sensitive anion transporter. Abca1 is a key gatekeeper influencing intracellular cholesterol transport.
Swissprot Id B1AWZ8
Protein Accession # NP_038482
Nucleotide Accession # NM_013454
Protein Size (# AA) 2261
Molecular Weight 254kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Abca1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Abca1.
Protein Interactions Sptlc1; Ubc;
Write Your Own Review
You're reviewing:Abca1 Antibody - middle region (ARP43660_P050)
Your Rating