AASDHPPT Antibody - C-terminal region (ARP48777_P050)

Catalog No: ARP48777_P050

WB Suggested Anti-AASDHPPT Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AASDHPPT
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 86%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AASDHPPT (ARP48777_P050) antibody is Catalog # AAP48777 (Previous Catalog # AAPP28828)
• Reference: Joshi,A.K., (2003) J. Biol. Chem. 278 (35), 33142-33149

Target Info

• Gene Symbol: AASDHPPT
• Gene Full Name: Aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
• Alias Symbols: ACPS, LYS2, LYS5, CGI-80, AASD-PPT
• NCBI Gene Id: 60496
• Protein Name: L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
• Description of Target: AASDHPPT is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.
• Uniprot ID: Q9NRN7
• Protein Accession #: NP_056238
• Nucleotide Accession #: NM_015423
• Protein Size (# AA): 309
• Molecular Weight: 36kDa
• Protein Interactions: USP22; UBC; TRAF2; SIAH1; ZC3HC1; EHD4; EHD1; TRIP13; NOL3; SGTA; PLCG1; HNRNPH1; CAPZA2; FBXO6; PAXIP1; BABAM1; MDFI;