Search Antibody, Protein, and ELISA Kit Solutions

AARS antibody - C-terminal region (ARP40369_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40369_P050-FITC Conjugated

ARP40369_P050-HRP Conjugated

ARP40369_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Alanyl-tRNA synthetase
Protein Name:
Alanine--tRNA ligase, cytoplasmic
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-159852 from Santa Cruz Biotechnology.
Description of Target:
The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure. The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AARS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AARS.
The immunogen is a synthetic peptide directed towards the C terminal region of human AARS
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-AARS (ARP40369_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-AARS (ARP40369_P050) antibody is Catalog # AAP40369 (Previous Catalog # AAPP22113)
Printable datasheet for anti-AARS (ARP40369_P050) antibody
Sample Type Confirmation:

AARS is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...