AAP1 Recombinant Protein (Baker's yeast) (OPCA02041)

Catalog No: OPCA02041

AAP1 Recombinant Protein (Yeast) (OPCA02041) in SDS-PAGE showing the molecular weight of approximately 60.73 kDa.

Product Info

• Predicted Species Reactivity: Saccharomyces cerevisiae
• Product Format: Liquid or Lyophilized powder
• Host: Yeast
• Additional Information: Relevance: Positive effector of glycogen accumulation. May be involved in nutrient-sensing.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG
• Protein Sequence: MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-389 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Global analysis of protein expression in yeast.Ghaemmaghami S., Huh W.-K., Bower K., Howson R.W., Belle A., Dephoure N., O'Shea E.K., Weissman J.S.Nature 425:737-741(2003)
• Gene Symbol: AAP1
• Gene Full Name: arginine/alanine aminopeptidase
• Alias Symbols: AAP1';arginine/alanine aminopeptidase;YHR047C.
• NCBI Gene Id: 856443
• Protein Name: Alanine/arginine aminopeptidase
• Description of Target: Positive effector of glycogen accumulation. May be involved in nutrient-sensing.
• Uniprot ID: P37898
• Protein Accession #: NP_011913.1
  
• Nucleotide Accession #: NM_001179177.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 60.8 kDa