Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP72542_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP72542_P050-FITC Conjugated

ARP72542_P050-HRP Conjugated

ARP72542_P050-Biotin Conjugated

AAAS Antibody - N-terminal region (ARP72542_P050)

Catalog#: ARP72542_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-118322 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human AAAS
Purification Affinity Purified
Peptide Sequence Synthetic peptide located within the following region: EHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-AAAS (ARP72542_P050) antibody is Catalog # AAP72542
Datasheets/Manuals Printable datasheet for anti-AAAS (ARP72542_P050) antibody
Gene Symbol AAAS
Alias Symbols AAAS, ADRACALA, GL003,
NCBI Gene Id 8086
Description of Target The protein encoded by this gene is a member of the WD-repeat family of regulatory proteins and may be involved in normal development of the peripheral and central nervous system. The encoded protein is part of the nuclear pore complex and is anchored there by NDC1. Defects in this gene are a cause of achalasia-addisonianism-alacrima syndrome (AAAS), also called triple-A syndrome or Allgrove syndrome. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot Id Q9NRG9
Protein Accession # NP_056480
Protein Size (# AA) 546
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AAAS.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AAAS.
Protein Interactions UBC; SUMO1; NEDD8; REL; ISG15;
  1. What is the species homology for "AAAS Antibody - N-terminal region (ARP72542_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "AAAS Antibody - N-terminal region (ARP72542_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AAAS Antibody - N-terminal region (ARP72542_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AAAS Antibody - N-terminal region (ARP72542_P050)"?

    This target may also be called "AAAS, ADRACALA, GL003, " in publications.

  5. What is the shipping cost for "AAAS Antibody - N-terminal region (ARP72542_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AAAS Antibody - N-terminal region (ARP72542_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AAAS Antibody - N-terminal region (ARP72542_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AAAS Antibody - N-terminal region (ARP72542_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "AAAS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AAAS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AAAS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AAAS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AAAS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AAAS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AAAS Antibody - N-terminal region (ARP72542_P050)
Your Rating