Search Antibody, Protein, and ELISA Kit Solutions

AAAS Antibody - N-terminal region (ARP72542_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72542_P050-FITC Conjugated

ARP72542_P050-HRP Conjugated

ARP72542_P050-Biotin Conjugated

Gene Symbol:
AAAS
NCBI Gene Id:
8086
Swissprot Id:
Q9NRG9
Protein Accession #:
NP_056480
Alias Symbols:
AAAS, ADRACALA, GL003,
Replacement Item:
This antibody may replace item sc-118322 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the WD-repeat family of regulatory proteins and may be involved in normal development of the peripheral and central nervous system. The encoded protein is part of the nuclear pore complex and is anchored there by NDC1. Defects in this gene are a cause of achalasia-addisonianism-alacrima syndrome (AAAS), also called triple-A syndrome or Allgrove syndrome. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
546
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AAAS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AAAS.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human AAAS
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; SUMO1; NEDD8; REL; ISG15;
Blocking Peptide:
For anti-AAAS (ARP72542_P050) antibody is Catalog # AAP72542
Datasheets/Manuals:
Printable datasheet for anti-AAAS (ARP72542_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...