Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

A830039H10RIK Antibody - C-terminal region (ARP37512_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37512_T100-FITC Conjugated

ARP37512_T100-HRP Conjugated

ARP37512_T100-Biotin Conjugated

Gene Symbol:
Lcorl
Official Gene Full Name:
Ligand dependent nuclear receptor corepressor-like
NCBI Gene Id:
209707
Protein Name:
Ligand-dependent nuclear receptor corepressor-like protein
Swissprot Id:
Q8CJG4
Protein Accession #:
NP_742165
Nucleotide Accession #:
NM_172153
Alias Symbols:
Mlr1, A830039H10RIK
Replacement Item:
This antibody may replace item sc-146686 from Santa Cruz Biotechnology.
Description of Target:
This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Protein Size (# AA):
517
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express A830039H10RIK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express A830039H10RIK.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-A830039H10RIK (ARP37512_T100)
Peptide Sequence:
Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Lcorl (ARP37512_T100) antibody is Catalog # AAP37512 (Previous Catalog # AAPP09620)
Datasheets/Manuals:
Printable datasheet for anti-Lcorl (ARP37512_T100) antibody
Target Reference:
Blackshaw,S., (2004) PLoS Biol. 2 (9), E247

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...