Catalog No: ARP58203_P050-HRP
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

A2BP1 Antibody - middle region : HRP (ARP58203_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-RBFOX1 (ARP58203_P050-HRP) antibody
Product Info
ReferenceUhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Horse, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP: Horseradish Peroxidase
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human A2BP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP
Concentration0.5 mg/ml
Blocking PeptideFor anti-RBFOX1 (ARP58203_P050-HRP) antibody is Catalog # AAP58203 (Previous Catalog # AAPP32802)
Gene SymbolRBFOX1
Gene Full NameRNA binding protein, fox-1 homolog (C. elegans) 1
Alias Symbols2BP1, FOX1, A2BP1, FOX-1, HRNBP1
NCBI Gene Id54715
Protein NameRNA binding protein fox-1 homolog 1
Description of TargetAtaxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.Ataxin-2 binding protein 1 has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Four alternatively spliced transcript variants have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.
Uniprot IDQ9NWB1
Protein Accession #NP_665900
Nucleotide Accession #NM_145893
Protein Size (# AA)395
Molecular Weight42kDa
  1. What is the species homology for "A2BP1 Antibody - middle region : HRP (ARP58203_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Horse, Zebrafish".

  2. How long will it take to receive "A2BP1 Antibody - middle region : HRP (ARP58203_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "A2BP1 Antibody - middle region : HRP (ARP58203_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact

  4. What are other names for "A2BP1 Antibody - middle region : HRP (ARP58203_P050-HRP)"?

    This target may also be called "2BP1, FOX1, A2BP1, FOX-1, HRNBP1" in publications.

  5. What is the shipping cost for "A2BP1 Antibody - middle region : HRP (ARP58203_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "A2BP1 Antibody - middle region : HRP (ARP58203_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "A2BP1 Antibody - middle region : HRP (ARP58203_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "A2BP1 Antibody - middle region : HRP (ARP58203_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RBFOX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RBFOX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RBFOX1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RBFOX1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RBFOX1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RBFOX1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:A2BP1 Antibody - middle region : HRP (ARP58203_P050-HRP)
Your Rating
We found other products you might like!