Search Antibody, Protein, and ELISA Kit Solutions

A1BG Western Blot kit (AWBK33810)

10 reactions
$549.00
In Stock
Request Bulk Order Quote
Gene Symbol:
A1BG
NCBI Gene Id:
1
Alias Symbols:
A1B, ABG, GAB, HYST2477,
Replacement Item:
This antibody may replace item sc-101879 from Santa Cruz Biotechnology.
Protein Name:
Alpha-1B-glycoprotein
Swissprot Id:
P04217
Kit Component:
Each kit contains sufficient reagents for 10 reactions, including blocking reagent, positive control, antibody #1, and antibody #2.
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express A1BG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express A1BG.
Datasheets/Manuals:
Printable datasheet for anti-A1BG (AWBK33810) antibody
Quality Control:
Tested on western blot
Protein Interactions:
SETD7; PRDX4; ABCC6; TK1; SNCA; SMN1; GRB7; CDKN1A; ANXA7; CRISP3;
Peptide Sequence:
Synthetic peptide located within the following region: LRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYRTDGEGAL
Introduction:
Western blot kits are based on quality antibodies and other reagents made by Aviva Systems Biology. These kits allow detecting specific protein by western blot.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...