SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP33810_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP33810_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-ACAT2 (ARP33810_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
Concentration0.5 mg/ml
Blocking PeptideFor anti-ACAT2 (ARP33810_P050-Biotin) antibody is Catalog # AAP33810 (Previous Catalog # AAPP04876)
Sample Type Confirmation

ACAT2 is supported by BioGPS gene expression data to be expressed in 721_B, HepG2, Jurkat

ReferenceUdby,L., et al., (2004) Biochemistry 43 (40), 12877-12886
Publications

Abdi, F. et al. Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders. J. Alzheimers. Dis. 9, 293-348 (2006). WB, Human 16914840

Abdul-Rahman, P. S., Lim, B.-K. & Hashim, O. H. Expression of high-abundance proteins in sera of patients with endometrial and cervical cancers: analysis using 2-DE with silver staining and lectin detection methods. Electrophoresis 28, 1989-96 (2007). WB, Human 17503403

Tian, M. et al. Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients. BMC Cancer 8, 241 (2008). WB, Human 18706098

Surin, B. et al. LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy. Proteomics 13, 142-52 (2013). WB, Human 23161552

Kim, Y.-S. et al. Apolipoprotein A-IV as a novel gene associated with polycystic ovary syndrome. Int. J. Mol. Med. 31, 707-16 (2013). WB, IP, ICC/IF, Human 23338533

Gene SymbolACAT2
Gene Full NameAcetyl-CoA acetyltransferase 2
Alias SymbolsA1B, ABG, GAB, HYST2477, A1BG
NCBI Gene Id39
Protein NameAlpha-1B-glycoprotein
Description of TargetA1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Uniprot IDP04217
Protein Accession #NP_570602
Nucleotide Accession #NM_130786
Protein Size (# AA)495
Molecular Weight54kDa
Protein InteractionsLNX1; ACAT2; UBC; SUMO2; OLA1; TUBB3; PAPSS1; UBA3; PKM; HMGB3; HEXA; FH; ALDH9A1; AHCY; BAG3; TTC39C; PSAT1; SSU72; DAK; VASP; TERF1; CDX2; CSNK2A1;
  1. What is the species homology for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?

    This target may also be called "A1B, ABG, GAB, HYST2477, A1BG" in publications.

  5. What is the shipping cost for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACAT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACAT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACAT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACAT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACAT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACAT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)
Your Rating
We found other products you might like!