- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)
Datasheets/Manuals | Printable datasheet for anti-ACAT2 (ARP33810_P050-Biotin) antibody |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Human: 100% |
Peptide Sequence | Synthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-ACAT2 (ARP33810_P050-Biotin) antibody is Catalog # AAP33810 (Previous Catalog # AAPP04876) |
Sample Type Confirmation | ACAT2 is supported by BioGPS gene expression data to be expressed in 721_B, HepG2, Jurkat |
Reference | Udby,L., et al., (2004) Biochemistry 43 (40), 12877-12886 |
Publications | Abdi, F. et al. Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders. J. Alzheimers. Dis. 9, 293-348 (2006). WB, Human 16914840 Abdul-Rahman, P. S., Lim, B.-K. & Hashim, O. H. Expression of high-abundance proteins in sera of patients with endometrial and cervical cancers: analysis using 2-DE with silver staining and lectin detection methods. Electrophoresis 28, 1989-96 (2007). WB, Human 17503403 Tian, M. et al. Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients. BMC Cancer 8, 241 (2008). WB, Human 18706098 Surin, B. et al. LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy. Proteomics 13, 142-52 (2013). WB, Human 23161552 Kim, Y.-S. et al. Apolipoprotein A-IV as a novel gene associated with polycystic ovary syndrome. Int. J. Mol. Med. 31, 707-16 (2013). WB, IP, ICC/IF, Human 23338533 |
Gene Symbol | ACAT2 |
---|---|
Gene Full Name | Acetyl-CoA acetyltransferase 2 |
Alias Symbols | A1B, ABG, GAB, HYST2477, A1BG |
NCBI Gene Id | 39 |
Protein Name | Alpha-1B-glycoprotein |
Description of Target | A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. |
Uniprot ID | P04217 |
Protein Accession # | NP_570602 |
Nucleotide Accession # | NM_130786 |
Protein Size (# AA) | 495 |
Molecular Weight | 54kDa |
Protein Interactions | LNX1; ACAT2; UBC; SUMO2; OLA1; TUBB3; PAPSS1; UBA3; PKM; HMGB3; HEXA; FH; ALDH9A1; AHCY; BAG3; TTC39C; PSAT1; SSU72; DAK; VASP; TERF1; CDX2; CSNK2A1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?
This target may also be called "A1B, ABG, GAB, HYST2477, A1BG" in publications.
-
What is the shipping cost for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "54kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "A1BG Antibody - N-terminal region : Biotin (ARP33810_P050-Biotin)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ACAT2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ACAT2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ACAT2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ACAT2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ACAT2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ACAT2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.