Catalog No: ARP33810_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-A1BG (ARP33810_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
Concentration0.5 mg/ml
Blocking PeptideFor anti-A1BG (ARP33810_P050) antibody is Catalog # AAP33810 (Previous Catalog # AAPP04876)
ReferenceUdby,L., et al., (2004) Biochemistry 43 (40), 12877-12886

Abdi, F. et al. Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders. J. Alzheimers. Dis. 9, 293-348 (2006). 16914840

Abdul-Rahman, P. S., Lim, B.-K. & Hashim, O. H. Expression of high-abundance proteins in sera of patients with endometrial and cervical cancers: analysis using 2-DE with silver staining and lectin detection methods. Electrophoresis 28, 1989-96 (2007). 17503403

Kim, Y.-S. et al. Apolipoprotein A-IV as a novel gene associated with polycystic ovary syndrome. Int. J. Mol. Med. 31, 707-16 (2013). 23338533

Surin, B. et al. LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy. Proteomics 13, 142-52 (2013). 23161552

Tian, M. et al. Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients. BMC Cancer 8, 241 (2008). 18706098

Gene SymbolA1BG
Gene Full Namealpha-1-B glycoprotein
Alias SymbolsA1B, ABG, GAB, HYST2477
NCBI Gene Id1
Protein NameAlpha-1B-glycoprotein
Description of TargetA1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Uniprot IDP04217
Protein Accession #NP_570602
Nucleotide Accession #NM_130786
Protein Size (# AA)495
Molecular Weight54kDa
Protein InteractionsSETD7; PRDX4; ABCC6; TK1; SNCA; SMN1; GRB7; CDKN1A; ANXA7; CRISP3;
  1. What is the species homology for "A1BG Antibody - N-terminal region (ARP33810_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "A1BG Antibody - N-terminal region (ARP33810_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "A1BG Antibody - N-terminal region (ARP33810_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "A1BG Antibody - N-terminal region (ARP33810_P050)"?

    This target may also be called "A1B, ABG, GAB, HYST2477" in publications.

  5. What is the shipping cost for "A1BG Antibody - N-terminal region (ARP33810_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "A1BG Antibody - N-terminal region (ARP33810_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "A1BG Antibody - N-terminal region (ARP33810_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "A1BG Antibody - N-terminal region (ARP33810_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "A1BG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "A1BG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "A1BG"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "A1BG"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "A1BG"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "A1BG"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:A1BG Antibody - N-terminal region (ARP33810_P050)
Your Rating
We found other products you might like!