Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33810_P050-FITC Conjugated

ARP33810_P050-HRP Conjugated

ARP33810_P050-Biotin Conjugated

A1BG Antibody - N-terminal region (ARP33810_P050)

Catalog#: ARP33810_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-118190 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Complete computational species homology dataAnti-A1BG (ARP33810_P050)
Peptide SequenceSynthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-A1BG (ARP33810_P050) antibody is Catalog # AAP33810 (Previous Catalog # AAPP04876)
Datasheets/ManualsPrintable datasheet for anti-A1BG (ARP33810_P050) antibody
Target ReferenceUdby,L., et al., (2004) Biochemistry 43 (40), 12877-12886

Abdi, F. et al. Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders. J. Alzheimers. Dis. 9, 293-348 (2006). WB, Human 16914840

Abdul-Rahman, P. S., Lim, B.-K. & Hashim, O. H. Expression of high-abundance proteins in sera of patients with endometrial and cervical cancers: analysis using 2-DE with silver staining and lectin detection methods. Electrophoresis 28, 1989-96 (2007). WB, Human 17503403

Kim, Y.-S. et al. Apolipoprotein A-IV as a novel gene associated with polycystic ovary syndrome. Int. J. Mol. Med. 31, 707-16 (2013). WB, Human 23338533

Surin, B. et al. LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy. Proteomics 13, 142-52 (2013). WB, Human 23161552

Tian, M. et al. Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients. BMC Cancer 8, 241 (2008). WB, Human 18706098

Gene SymbolA1BG
Official Gene Full Namealpha-1-B glycoprotein
Alias SymbolsA1B, ABG, GAB, HYST2477, A1BG
NCBI Gene Id1
Protein NameAlpha-1B-glycoprotein
Description of TargetA1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Swissprot IdP04217
Protein Accession #NP_570602
Nucleotide Accession #NM_130786
Protein Size (# AA)495
Molecular Weight54kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express A1BG.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express A1BG.
Protein InteractionsSETD7; PRDX4; ABCC6; TK1; SNCA; SMN1; GRB7; CDKN1A; ANXA7; CRISP3;
Write Your Own Review
You're reviewing:A1BG Antibody - N-terminal region (ARP33810_P050)
Your Rating
Aviva Blast Tool
Assay Development
Aviva Pathways
Aviva Tips and Tricks