Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

A1BG Antibody - N-terminal region (ARP33810_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33810_P050-FITC Conjugated

ARP33810_P050-HRP Conjugated

ARP33810_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
alpha-1-B glycoprotein
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-118190 from Santa Cruz Biotechnology.
Description of Target:
A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express A1BG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express A1BG.
The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
Predicted Species Reactivity:
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-A1BG (ARP33810_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-A1BG (ARP33810_P050) antibody is Catalog # AAP33810 (Previous Catalog # AAPP04876)
Printable datasheet for anti-A1BG (ARP33810_P050) antibody
Target Reference:
Udby,L., et al., (2004) Biochemistry 43 (40), 12877-12886

Abdi, F. et al. Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders. J. Alzheimers. Dis. 9, 293-348 (2006). WB, Human 16914840

Abdul-Rahman, P. S., Lim, B.-K. & Hashim, O. H. Expression of high-abundance proteins in sera of patients with endometrial and cervical cancers: analysis using 2-DE with silver staining and lectin detection methods. Electrophoresis 28, 1989-96 (2007). WB, Human 17503403

Kim, Y.-S. et al. Apolipoprotein A-IV as a novel gene associated with polycystic ovary syndrome. Int. J. Mol. Med. 31, 707-16 (2013). WB, Human 23338533

Surin, B. et al. LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy. Proteomics 13, 142-52 (2013). WB, Human 23161552

Tian, M. et al. Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients. BMC Cancer 8, 241 (2008). WB, Human 18706098

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...