Search Antibody, Protein, and ELISA Kit Solutions

A1BG antibody - N-terminal region (ARP33810_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33810_P050-FITC Conjugated

ARP33810_P050-HRP Conjugated

ARP33810_P050-Biotin Conjugated

Gene Symbol:
A1BG
NCBI Gene Id:
1
Official Gene Full Name:
alpha-1-B glycoprotein
Protein Name:
Alpha-1B-glycoprotein
Swissprot Id:
P04217
Protein Accession #:
NP_570602
Nucleotide Accession #:
NM_130786
Alias Symbols:
A1B, ABG, GAB, HYST2477, A1BG
Replacement Item:
This antibody may replace item sc-118190 from Santa Cruz Biotechnology.
Description of Target:
A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Protein Size (# AA):
495
Molecular Weight:
54kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express A1BG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express A1BG.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-A1BG (ARP33810_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SETD7; PRDX4; ABCC6; TK1; SNCA; SMN1; GRB7; CDKN1A; ANXA7; CRISP3;
Blocking Peptide:
For anti-A1BG (ARP33810_P050) antibody is Catalog # AAP33810 (Previous Catalog # AAPP04876)
Datasheets/Manuals:
Printable datasheet for anti-A1BG (ARP33810_P050) antibody
Target Reference:
Udby,L., et al., (2004) Biochemistry 43 (40), 12877-12886
Publications:

Abdi, F. et al. Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders. J. Alzheimers. Dis. 9, 293-348 (2006). WB, Human 16914840

Abdul-Rahman, P. S., Lim, B.-K. & Hashim, O. H. Expression of high-abundance proteins in sera of patients with endometrial and cervical cancers: analysis using 2-DE with silver staining and lectin detection methods. Electrophoresis 28, 1989-96 (2007). WB, Human 17503403

Tian, M. et al. Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients. BMC Cancer 8, 241 (2008). WB, Human 18706098

Surin, B. et al. LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy. Proteomics 13, 142-52 (2013). WB, Human 23161552

Kim, Y.-S. et al. Apolipoprotein A-IV as a novel gene associated with polycystic ovary syndrome. Int. J. Mol. Med. 31, 707-16 (2013). WB, Human 23338533

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...