Now Offering Over 102,157 Antibodies & 44,722 Antigens!

9530077C05RIK Antibody - middle region (ARP96156_P050)

100 ul
$289.00
In Stock
Gene Symbol:
9530077C05RIK
NCBI Gene Id:
68283
Official Gene Full Name:
RIKEN cDNA 9530077C05 gene
Protein Name:
uncharacterized protein KIAA0895
Swissprot Id:
Q7TQE7
Protein Accession #:
NP_081015.1
Nucleotide Accession #:
NM_026739.1
Alias Symbols:
mKIAA0895, 1110003N12Rik
Protein Size (# AA):
519
Molecular Weight:
57 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 9530077C05RIK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 9530077C05RIK.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse KIAA0895
Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: GINNLQQPWNSWIGRKKHELKPNNPTEEGLASIHSVLFRKDPFLWRAALL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-9530077C05RIK (ARP96156_P050) antibody is Catalog # AAP96156
Datasheets/Manuals:
Printable datasheet for anti-9530077C05RIK (ARP96156_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...