53BP1 Antibody (Phospho-Ser6) (OAAF07505)

Catalog No: OAAF07505 (Formerly GWB-ASB310)

Size:100 ug

Click here to learn more about Aviva's By-Request Conjugation Service.

Western blot analysis of lysates from COS7 cells treated with insulin 0.01U/ML 15', using 53BP1 (Phospho-Ser6) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human heart, using 53BP1 (Phospho-Ser6) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Monkey|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:S6 Mouse:S6 Rat:S11
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human 53BP1 around the phosphorylation site of Ser6.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNL
• Concentration: 1mg/ml
• Specificity: 53BP1 (Phospho-Ser6) Antibody detects endogenous levels of 53BP1 only when phosphorylated at Ser6.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  ELISA: 1:5000

Target Info

• Gene Symbol: TP53BP1
• Gene Full Name: tumor protein p53 binding protein 1
• Alias Symbols: 53BP1;p202;p53-binding protein 1;p53BP1;TDRD30;TP53-binding protein 1;tumor protein 53-binding protein, 1;tumor suppressor p53-binding protein 1.
• NCBI Gene Id: 7158
• Protein Name: TP53-binding protein 1
• Description of Target: Double-strand break (DSB) repair protein involved in response to DNA damage, telomere dynamics and class-switch recombination (CSR) during antibody genesis (PubMed:12364621, PubMed:22553214, PubMed:23333306, PubMed:17190600, PubMed:21144835, PubMed:28241136). Plays a key role in the repair of double-strand DNA breaks (DSBs) in response to DNA damage by promoting non-homologous end joining (NHEJ)-mediated repair of DSBs and specifically counteracting the function of the homologous recombination (HR) repair protein BRCA1 (PubMed:22553214, PubMed:23727112, PubMed:23333306). In response to DSBs, phosphorylation by ATM promotes interaction with RIF1 and dissociation from NUDT16L1/TIRR, leading to recruitment to DSBs sites (PubMed:28241136). Recruited to DSBs sites by recognizing and binding histone H2A monoubiquitinated at 'Lys-15' (H2AK15Ub) and histone H4 dimethylated at 'Lys-20' (H4K20me2), two histone marks that are present at DSBs sites (PubMed:23760478, PubMed:28241136, PubMed:17190600). Required for immunoglobulin class-switch recombination (CSR) during antibody genesis, a process that involves the generation of DNA DSBs (PubMed:23345425). Participates to the repair and the orientation of the broken DNA ends during CSR (By similarity). In contrast, it is not required for classic NHEJ and V(D)J recombination (By similarity). Promotes NHEJ of dysfunctional telomeres via interaction with PAXIP1 (PubMed:23727112).
• Uniprot ID: Q12888
• Molecular Weight: 213 kDa