Search Antibody, Protein, and ELISA Kit Solutions

4933434E20Rik Antibody - N-terminal region (ARP54536_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54536_P050-FITC Conjugated

ARP54536_P050-HRP Conjugated

ARP54536_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
RIKEN cDNA 4933434E20 gene
NCBI Gene Id:
Protein Name:
Uncharacterized protein C1orf43 homolog
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
NICE-3, NS5ATP4, AI462154, 5730552F22Rik
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 4933434E20Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 4933434E20Rik.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-4933434E20Rik (ARP54536_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-4933434E20Rik (ARP54536_P050) antibody is Catalog # AAP54536 (Previous Catalog # AAPP31320)
Printable datasheet for anti-4933434E20Rik (ARP54536_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...