Search Antibody, Protein, and ELISA Kit Solutions

1700047I17RIK2 Antibody - middle region (ARP95829_P050)

100 ul
In Stock
Request Bulk Order Quote
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
RIKEN cDNA 1700047I17 gene 2
Protein Name:
protein FAM177A1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
22 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 1700047I17RIK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 1700047I17RIK2.
The immunogen is a synthetic peptide directed towards the middle region of mouse FAM177A1
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: YYRMKKEEEEEEEENRMSEEAERQYQQNKLQADSIVQTDQPETVSSSFVN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-1700047I17RIK2 (ARP95829_P050) antibody is Catalog # AAP95829
Printable datasheet for anti-1700047I17RIK2 (ARP95829_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...