14-3-3 thet/tau Antibody (Phospho-Ser232) (OAAF07503)

Catalog No: OAAF07503 (Formerly GWB-ASB308)

Size:100 ug

Western blot analysis of lysates from HeLa cells, using 14-3-3 thet/tau (Phospho-Ser232) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human pancreas, using 14-3-3 thet/tau (Phospho-Ser232) Antibody. The picture on the right is blocked with the phospho peptide.

Immunofluorescence analysis of HeLa cells, using 14-3-3 thet/tau (Phospho-Ser232) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:S232 Mouse:S232
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human 14-3-3 thet/tau around the phosphorylation site of Ser232.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: FDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
• Concentration: 1mg/ml
• Specificity: 14-3-3 thet/tau (Phospho-Ser232) Antibody detects endogenous levels of 14-3-3 thet/tau only when phosphorylated at Ser232.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  IF: 1:100~1:500
  ELISA: 1:5000

Target Info

• Gene Symbol: PLN|YWHAQ
• Gene Full Name: phospholamban|tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
• Alias Symbols: 14-3-3;14-3-3 protein tau;14-3-3 protein T-cell;14-3-3 protein theta;14-3-3 theta;1C5;cardiac phospholamban;CMD1P;CMH18;HS1;PLB;Protein HS1;protein, theta;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide.
• NCBI Gene Id: 10971|5350
• Protein Name: 14-3-3 protein theta
• Description of Target: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
• Uniprot ID: P27348
• Molecular Weight: 27 kDa