ZP3 Antibody - C-terminal region (ARP35855_T100)

Catalog No: ARP35855_T100

WB Suggested Anti-ZP3 Antibody Titration: 0.6ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Host: Rabbit
Target: ZP3
Positive control (+): MCF7 Cell Lysate (N10)
Negative control (-): Human Kidney (KI)
Antibody concentration: 5ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZP3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 90%
• Peptide Sequence: Synthetic peptide located within the following region: NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGATDLPGQEW
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-ZP3 (ARP35855_T100) antibody is Catalog # AAP35855 (Previous Catalog # AAPP07111)
• Reference: Chamberlin,M.E., et al., (1990) Proc. Natl. Acad. Sci. U.S.A. 87 (16), 6014-6018
• Publications:

  Morphometric characteristics of preantral and antral follicles and expression of factors involved in folliculogenesis in ovaries of adult baboons (Papio anubis). 26945754

  Törmälä, R.-M. et al. Zona pellucida components are present in human fetal ovary before follicle formation. Mol. Cell. Endocrinol. 289, 10-5 (2008). 18502569

Target Info

• Gene Symbol: ZP3
• Gene Full Name: Zona pellucida glycoprotein 3 (sperm receptor)
• Alias Symbols: ZPC, ZP3A, ZP3B, Zp-3, OOMD3
• NCBI Gene Id: 7784
• Protein Name: Zona pellucida sperm-binding protein 3
• Description of Target: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene
• Uniprot ID: P21754-2
• Protein Size (# AA): 424
• Molecular Weight: 47kDa
• Protein Interactions: HECW2; OR2L13; SPACA3; MICALL1; MRPS16; PCDH17; UBAP2L; UBC; ENGASE; ACR; FURIN;