ZNF295 Antibody - N-terminal region (ARP32731_P050)

Catalog No: ARP32731_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-ZNF295 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF295
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: DQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCEPDAFDNVLNYI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZBTB21 (ARP32731_P050) antibody is Catalog # AAP32731 (Previous Catalog # AAPP03745)
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

Target Info

• Gene Symbol: ZBTB21
• Gene Full Name: Zinc finger protein 295
• Alias Symbols: ZNF295
• NCBI Gene Id: 49854
• Protein Name: Zinc finger protein 295
• Description of Target: ZNF295 contains 1 BTB (POZ) domain and 8 C2H2-type zinc fingers. ZNF295 may be involved in transcriptional regulation.
• Uniprot ID: Q9ULJ3
• Protein Accession #: NP_065778
• Nucleotide Accession #: NM_020727
• Protein Size (# AA): 1066
• Molecular Weight: 119kDa
• Protein Interactions: SUMO2; KLHL29; PASK; ZBTB21; ZBTB14; YWHAG; PPP2R2B;