ZNF277 Antibody - N-terminal region (ARP39528_P050)

Catalog No: ARP39528_P050

WB Suggested Anti-ZNF277 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysateZNF277 is supported by BioGPS gene expression data to be expressed in OVCAR3

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF277
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZNF277 (ARP39528_P050) antibody is Catalog # AAP39528 (Previous Catalog # AAPS05509)
• Sample Type Confirmation:

  ZNF277 is supported by BioGPS gene expression data to be expressed in OVCAR3

Target Info

• Gene Symbol: ZNF277
• Gene Full Name: Zinc finger protein 277
• Alias Symbols: NRIF4, ZNF277P
• NCBI Gene Id: 11179
• Protein Name: Zinc finger protein 277
• Description of Target: ZNF277 may be involved in transcriptional regulation.
• Uniprot ID: Q9NRM2
• Protein Accession #: NP_068834
• Nucleotide Accession #: NM_021994
• Protein Size (# AA): 450
• Molecular Weight: 53kDa
• Protein Interactions: NUTM1; MBD3; COIL; GNGT1; UBC; ZNF768; ZBTB7B; DDB1; ACOT2;