ZNF16 Antibody - N-terminal region (ARP35817_P050)

Catalog No: ARP35817_P050

WB Suggested Anti-ZNF16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF16
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PYDMGGQSFQHSVDLTGHEGVPTAESPLICNECGKTFQGNPDLIQRQIVH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZNF16 (ARP35817_P050) antibody is Catalog # AAP35817 (Previous Catalog # AAPP07069)
• Reference: Dreier,B., (2000) J. Mol. Biol. 303 (4), 489-502

Target Info

• Gene Symbol: ZNF16
• Gene Full Name: Zinc finger protein 16
• Alias Symbols: HZF1, KOX9
• NCBI Gene Id: 7564
• Protein Name: Zinc finger protein 16
• Description of Target: ZNF16 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 17 C2H2-type zinc fingers. ZNF16 may be involved in transcriptional regulation.The protein encoded by this gene contains a C2H2 type of zinc finger, and thus may function as a transcription factor. This gene is located in a region close to ZNF7/KOX4, a gene also encoding a zinc finger protein, on chromosome 8. Two alternatively spliced variants, encoding the same protein, have been identified.
• Uniprot ID: P17020
• Protein Accession #: NP_001025147
• Nucleotide Accession #: NM_001029976
• Protein Size (# AA): 682
• Molecular Weight: 76kDa
• Protein Interactions: ZNF101; GORAB;