SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP39141_P050
Price: $0.00
SKU
ARP39141_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ZEB2 (ARP39141_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZEB2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
Concentration0.5 mg/ml
Blocking PeptideFor anti-ZEB2 (ARP39141_P050) antibody is Catalog # AAP39141 (Previous Catalog # AAPP21250)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceVerstappen,G., (2008) Hum. Mol. Genet. 17 (8), 1175-1183
Publications

Guan, H. et al. Down-regulation of miR-144 promotes thyroid cancer cell invasion by targeting ZEB1 and ZEB2. Endocrine. doi:10.1007/s12020-014-0326-7 (2014). 24968735

Regulation of trunk neural crest delamination by dEF1 and Sip1 in the chicken embryo. Dev. Growth Differ. 58, 205-14 (2016). 26691438

Rogers, C. D., Saxena, A. & Bronner, M. E. Sip1 mediates an E-cadherin-to-N-cadherin switch during cranial neural crest EMT. J. Cell Biol. 203, 835-47 (2013). 24297751

Gene SymbolZEB2
Gene Full NameZinc finger E-box binding homeobox 2
Alias SymbolsSIP1, SIP-1, ZFHX1B, HSPC082, SMADIP1
NCBI Gene Id9839
Protein NameZinc finger E-box-binding homeobox 2
Description of TargetThe ZFHX1B gene is a member of the delta-EF1/Zfh1 family of 2-handed zinc finger/homeodomain proteins. ZFHX1B is strongly transcribed at an early stage in the developing peripheral and central nervous systems of both mice and humans, in all neuronal regions of the brains of 25-week human fetuses and adult mice, and in numerous nonneural tissues. The SMADIP1 gene (also known as SIP1) is a member of the delta-EF1 (ZEB1; MIM 189909)/Zfh1 family of 2-handed zinc finger/homeodomain proteins. SMADIP1 interacts with receptor-mediated, activated full-length SMADs (see MIM 605568) (Verschueren et al., 1999 [PubMed 10400677]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-58 AB056507.1 1-58 59-553 AL118674.1 57-551 554-5558 AB056507.1 553-5557 5559-5583 AI858477.1 1-25 c
Uniprot IDO60315
Protein Accession #NP_055610
Nucleotide Accession #NM_014795
Protein Size (# AA)1214
Molecular Weight25 kDa
Protein InteractionsCTBP1; SOX2; SMAD9; SMAD3; SMAD2; SMAD1; APP; HDAC4; CBX4; SUMO1; UBE2I; ELAVL1; UBC; MTA2; MTA1; RBBP7; RBBP4; HDAC2; HDAC1; CEBPA; COPS6; SMAD5; CTBP2;
  1. What is the species homology for "ZEB2 Antibody - middle region (ARP39141_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Zebrafish".

  2. How long will it take to receive "ZEB2 Antibody - middle region (ARP39141_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ZEB2 Antibody - middle region (ARP39141_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ZEB2 Antibody - middle region (ARP39141_P050)"?

    This target may also be called "SIP1, SIP-1, ZFHX1B, HSPC082, SMADIP1" in publications.

  5. What is the shipping cost for "ZEB2 Antibody - middle region (ARP39141_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZEB2 Antibody - middle region (ARP39141_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ZEB2 Antibody - middle region (ARP39141_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZEB2 Antibody - middle region (ARP39141_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ZEB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZEB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZEB2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZEB2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZEB2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZEB2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZEB2 Antibody - middle region (ARP39141_P050)
Your Rating
We found other products you might like!