Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP31808_P050
Price: $0.00
SKU
ARP31808_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ZC3H7B (ARP31808_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZC3H7B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: KPAPSPEPCMPNTALLIKNPLAATHEFKQACQLCYPKTGPRAGDYTYREG
Concentration0.5 mg/ml
Blocking PeptideFor anti-ZC3H7B (ARP31808_P050) antibody is Catalog # AAP31808 (Previous Catalog # AAPP02603)
Sample Type Confirmation

There is BioGPS gene expression data showing that ZC3H7B is expressed in 721_B

ReferenceLim,J., (2006) Cell 125 (4), 801-814
Gene SymbolZC3H7B
Gene Full NameZinc finger CCCH-type containing 7B
Alias SymbolsRoXaN, ROXAN1
NCBI Gene Id23264
Protein NameZinc finger CCCH domain-containing protein 7B
Description of TargetZC3H7B is a protein that contains a tetratricopeptide repeat domain. The encoded protein also interacts with the rotavirus non-structural protein NSP3. This gene encodes a protein that contains a tetratricopeptide repeat domain. The encoded protein also interacts with the rotavirus non-structural protein NSP3.
Uniprot IDQ9UGR2
Protein Accession #NP_060060
Nucleotide Accession #NM_017590
Protein Size (# AA)977
Molecular Weight110kDa
Protein InteractionsUBC; HECW2; HSP90AA1; RC3H1; UBXN6; ZYX; ATXN1L; ATXN1; EIF4G1;
  1. What is the species homology for "ZC3H7B Antibody - middle region (ARP31808_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ZC3H7B Antibody - middle region (ARP31808_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ZC3H7B Antibody - middle region (ARP31808_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ZC3H7B Antibody - middle region (ARP31808_P050)"?

    This target may also be called "RoXaN, ROXAN1" in publications.

  5. What is the shipping cost for "ZC3H7B Antibody - middle region (ARP31808_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZC3H7B Antibody - middle region (ARP31808_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ZC3H7B Antibody - middle region (ARP31808_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "110kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZC3H7B Antibody - middle region (ARP31808_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ZC3H7B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZC3H7B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZC3H7B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZC3H7B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZC3H7B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZC3H7B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZC3H7B Antibody - middle region (ARP31808_P050)
Your Rating