SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP50635_P050
Price: $0.00
SKU
ARP50635_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ZC3H15 Antibody - middle region (ARP50635_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ZC3H15 (ARP50635_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZC3H15
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: SGREVFEFRPELVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIP
Concentration0.5 mg/ml
Blocking PeptideFor anti-ZC3H15 (ARP50635_P050) antibody is Catalog # AAP50635 (Previous Catalog # AAPS29507)
ReferenceGregory,R.C., (2000) Cytokine 12 (7), 845-857
Gene SymbolZC3H15
Gene Full NameZinc finger CCCH-type containing 15
Alias SymbolsHT010, LEREPO4, MSTP012
NCBI Gene Id55854
Protein NameZinc finger CCCH domain-containing protein 15
Description of TargetZC3H15 belongs to the ZC3H15/TMA46 family. It contains 2 C3H1-type zinc fingers. ZC3H15 protects DRG1 from proteolytic degradation.
Uniprot IDQ8WU90
Protein Accession #NP_060941
Nucleotide Accession #NM_018471
Protein Size (# AA)426
Molecular Weight48kDa
Protein InteractionsDRG1; TRAF2; STAU1; UBC; RNF2; PARK2; PHKG2; CSNK2A1; THOC3; THOC7; THOC6; THOC2; ZCCHC8; TSSK2; PPIP5K2; THOC1; PPIP5K1; WASF1; THOC5; UTRN; ISG15; C8orf33; TNNT1;
  1. What is the species homology for "ZC3H15 Antibody - middle region (ARP50635_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "ZC3H15 Antibody - middle region (ARP50635_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ZC3H15 Antibody - middle region (ARP50635_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ZC3H15 Antibody - middle region (ARP50635_P050)"?

    This target may also be called "HT010, LEREPO4, MSTP012" in publications.

  5. What is the shipping cost for "ZC3H15 Antibody - middle region (ARP50635_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZC3H15 Antibody - middle region (ARP50635_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ZC3H15 Antibody - middle region (ARP50635_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZC3H15 Antibody - middle region (ARP50635_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ZC3H15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZC3H15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZC3H15"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZC3H15"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZC3H15"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZC3H15"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZC3H15 Antibody - middle region (ARP50635_P050)
Your Rating
We found other products you might like!