SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP30118_P050
Price: $0.00
SKU
ARP30118_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-YEATS4 (ARP30118_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human YEATS4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET
Concentration0.5 mg/ml
Blocking PeptideFor anti-YEATS4 (ARP30118_P050) antibody is Catalog # AAP30118 (Previous Catalog # AAPH00294)
Sample Type Confirmation

YEATS4 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceZimmermann,K., et al., (2002) J. Biol. Chem. 277 (21), 18626-18631
Gene SymbolYEATS4
Gene Full NameYEATS domain containing 4
Alias SymbolsYAF9, GAS41, NUBI-1, 4930573H17Rik, B230215M10Rik
NCBI Gene Id8089
Protein NameYEATS domain-containing protein 4
Description of TargetYEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
Uniprot IDO95619
Protein Accession #NP_006521
Nucleotide Accession #NM_006530
Protein Size (# AA)227
Molecular Weight25kDa
Protein InteractionsUBC; HECW2; LYN; TFAP2B; BRD3; VIM; UBTF; FRMD4A; KDM1A; RNF8; MYCN; MYC; H2AFZ; DMAP1; KAT5; tat; MRGBP; RUVBL2; RUVBL1; TACC1; TACC2; PFDN1; MLLT10; SMARCB1; NUMA1; ING3; CEP162;
  1. What is the species homology for "YEATS4 Antibody - middle region (ARP30118_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "YEATS4 Antibody - middle region (ARP30118_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "YEATS4 Antibody - middle region (ARP30118_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "YEATS4 Antibody - middle region (ARP30118_P050)"?

    This target may also be called "YAF9, GAS41, NUBI-1, 4930573H17Rik, B230215M10Rik" in publications.

  5. What is the shipping cost for "YEATS4 Antibody - middle region (ARP30118_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "YEATS4 Antibody - middle region (ARP30118_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "YEATS4 Antibody - middle region (ARP30118_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "YEATS4 Antibody - middle region (ARP30118_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "YEATS4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "YEATS4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "YEATS4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "YEATS4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "YEATS4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "YEATS4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:YEATS4 Antibody - middle region (ARP30118_P050)
Your Rating
We found other products you might like!