SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OAAF07902 (Formerly GWB-ASD258)
Size:100 ug
Price: $344.00
SKU
OAAF07902
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for XRCC3 Antibody (OAAF07902)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human XRCC3.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
Peptide SequenceSynthetic peptide located within the following region: LSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLD
Concentration1mg/ml
SpecificityXRCC3 Antibody detects endogenous levels of total XRCC3 protein.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application InfoWB: 1:500~1:1000
IHC: 1:50~1:100
ELISA: 1:5000
Gene SymbolXRCC3
Gene Full NameX-ray repair cross complementing 3
Alias SymbolsCMM6;DNA repair protein XRCC3;X-ray repair complementing defective repair in Chinese hamster cells 3;X-ray repair cross-complementing protein 3.
NCBI Gene Id7517
Protein NameDNA repair protein XRCC3
Description of TargetInvolved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Part of the RAD21 paralog protein complex CX3 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, CX3 acts downstream of RAD51 recruitment; the complex binds predominantly to the intersection of the four duplex arms of the Holliday junction (HJ) and to junctions of replication forks. Involved in HJ resolution and thus in processing HR intermediates late in the DNA repair process; the function may be linked to the CX3 complex and seems to involve GEN1 during mitotic cell cycle progression. Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and RAD51C.
Uniprot IDO43542
Molecular Weight37 kDa
  1. What is the species homology for "XRCC3 Antibody (OAAF07902)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "XRCC3 Antibody (OAAF07902)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "XRCC3 Antibody (OAAF07902)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "XRCC3 Antibody (OAAF07902)"?

    This target may also be called "CMM6;DNA repair protein XRCC3;X-ray repair complementing defective repair in Chinese hamster cells 3;X-ray repair cross-complementing protein 3." in publications.

  5. What is the shipping cost for "XRCC3 Antibody (OAAF07902)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "XRCC3 Antibody (OAAF07902)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "XRCC3 Antibody (OAAF07902)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "XRCC3 Antibody (OAAF07902)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "XRCC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "XRCC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "XRCC3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "XRCC3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "XRCC3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "XRCC3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:XRCC3 Antibody (OAAF07902)
Your Rating
We found other products you might like!