SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58980_P050
Price: $0.00
SKU
ARP58980_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-WIPI1 (ARP58980_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human WIPI1
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: LDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASS
Concentration0.5 mg/ml
Blocking PeptideFor anti-WIPI1 (ARP58980_P050) antibody is Catalog # AAP58980
ReferenceN/A
Gene SymbolWIPI1
Gene Full NameWD repeat domain, phosphoinositide interacting 1
Alias SymbolsATG18, ATG18A, WIPI49
NCBI Gene Id55062
Protein NameWD repeat domain phosphoinositide-interacting protein 1
Description of TargetWD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids.
Uniprot IDQ5MNZ9
Protein Accession #NP_060453
Protein Size (# AA)446
Molecular Weight49kDa
  1. What is the species homology for "WIPI1 Antibody - C-terminal region (ARP58980_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "WIPI1 Antibody - C-terminal region (ARP58980_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "WIPI1 Antibody - C-terminal region (ARP58980_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "WIPI1 Antibody - C-terminal region (ARP58980_P050)"?

    This target may also be called "ATG18, ATG18A, WIPI49" in publications.

  5. What is the shipping cost for "WIPI1 Antibody - C-terminal region (ARP58980_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "WIPI1 Antibody - C-terminal region (ARP58980_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "WIPI1 Antibody - C-terminal region (ARP58980_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "WIPI1 Antibody - C-terminal region (ARP58980_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "WIPI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "WIPI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "WIPI1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "WIPI1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "WIPI1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "WIPI1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:WIPI1 Antibody - C-terminal region (ARP58980_P050)
Your Rating
We found other products you might like!