WDR3 antibody - middle region (AVARP02043_P050)

Catalog#: AVARP02043_P050

• Size: 50ug

Human HeLa

• Description of Target: WDR3 is a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
• Gene Symbol: WDR3
• Official Gene Full Name: WD repeat domain 3
• Alias Symbols: FLJ12796; DIP2; UTP12
• Protein Accession#: NP_006775
• Nucleotide Accession#: NM_006784
• Swissprot Id: Q9UNX4
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 943
• Molecular Weight: 106kDa
• Application: WB
• Partner Proteins: BRAF, CBL, CDC25A, CDC25B, CDK11B, CRTC2, HCVgp1, IGF1R, RAF1, RAF1, TSC1, TSC2, UCP2, UCP3, ABL1, ADAM22, AKAP13, ALS2, ATP5A1, BAD, BCL2L11, BCR, BID, BRAF, C1QBP, C22orf9, CBL, CDC25A, CDC25B, CDC25C, CDK11B, CDK14, CDKN1B, CRTC2, CSNK2A1, DAPK1, DHX15, DYRK1A, EDC3, EPB41, EPB41L1, EPB41L3, F
• Immunogen: The immunogen for anti-WDR3 antibody: synthetic peptide directed towards the middle region of human WDR3
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Guinea pig: 93%; African clawed frog: 92%; Chicken: 85%; Rat: 80%; Zebrafish: 78%
• Peptide Sequence: Synthetic peptide located within the following region: VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT
• Blocking Peptide: For anti-WDR3 antibody is Catalog # AAP30640 (Previous Catalog # AAPP01293)
• Key Reference: Nousiainen,M., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (14), 5391-5396
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-WDR3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: WDR3 antibody tested with Human Hela Cells (AVARP02043_P050)

Aviva Systems Biology is the original manufacturer of this WDR3 antibody (AVARP02043_P050)

Click here to view the WDR3 antibody Western Blot Protocol

Product Datasheet Link: WDR3 antibody (AVARP02043_P050)

WB Suggested Anti-WDR3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela

Western Blot image:


Description of Target: WDR3 is a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s WDR3 antibody (AVARP02043_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com