Catalog No: ARP57644_P050
Price: $0.00
SKU
ARP57644_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-VPS52 (ARP57644_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human VPS52
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF
Concentration0.5 mg/ml
Blocking PeptideFor anti-VPS52 (ARP57644_P050) antibody is Catalog # AAP57644 (Previous Catalog # AAPP42031)
Sample Type Confirmation

VPS52 is supported by BioGPS gene expression data to be expressed in MCF7

Publications

Vaccinia virus uses retromer-independent cellular retrograde transport pathways to facilitate the wrapping of intracellular mature virions during viral morphogenesis. J. Virol. , (2016). 27581988

Gene SymbolVPS52
Gene Full NameVacuolar protein sorting 52 homolog (S. cerevisiae)
Alias SymbolsARE1, SAC2, SACM2L, dJ1033B10.5
NCBI Gene Id6293
Protein NameVacuolar protein sorting-associated protein 52 homolog
Description of TargetThis gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.
Uniprot IDQ8N1B4
Protein Accession #NP_072047
Nucleotide Accession #NM_022553
Protein Size (# AA)723
Molecular Weight82kDa
Protein InteractionsFAM184A; MRPL11; SH2D4A; CCDC146; THAP11; KIAA1217; TBC1D22B; HEATR1; C1orf109; METTL13; ATP6V1D; VPS28; KANK2; TXN2; RNF41; EPM2AIP1; WTAP; USP2; STX11; LMO4; TRAF6; TPM3; TEAD4; RAB4A; PRKAA2; PRKAA1; NOP2; NFKBIB; MFAP1; KIF5B; GOLGA1; DDX6; AAMP; TXLN
  1. What is the species homology for "VPS52 Antibody - middle region (ARP57644_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "VPS52 Antibody - middle region (ARP57644_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "VPS52 Antibody - middle region (ARP57644_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "VPS52 Antibody - middle region (ARP57644_P050)"?

    This target may also be called "ARE1, SAC2, SACM2L, dJ1033B10.5" in publications.

  5. What is the shipping cost for "VPS52 Antibody - middle region (ARP57644_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "VPS52 Antibody - middle region (ARP57644_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "VPS52 Antibody - middle region (ARP57644_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "82kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "VPS52 Antibody - middle region (ARP57644_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "VPS52"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "VPS52"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "VPS52"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "VPS52"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "VPS52"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "VPS52"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:VPS52 Antibody - middle region (ARP57644_P050)
Your Rating
We found other products you might like!