VPS4A Antibody - N-terminal region (ARP54916_P050)

Catalog No: ARP54916_P050

WB Suggested Anti-VPS4A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS4A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-VPS4A (ARP54916_P050) antibody is Catalog # AAP54916 (Previous Catalog # AAPP31871)
• Reference: Taylor,G.M., (2007) J. Virol. 81 (24), 13631-13639

Target Info

• Gene Symbol: VPS4A
• Gene Full Name: Vacuolar protein sorting 4 homolog A (S. cerevisiae)
• Alias Symbols: SKD1, SKD2, VPS4, SKD1A, VPS4-1
• NCBI Gene Id: 27183
• Protein Name: Vacuolar protein sorting-associated protein 4A
• Description of Target: VPS4A is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast.The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. The mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be really an yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 16; the gene for the other resides on chromosome 18. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9UN37
• Protein Accession #: NP_037377
• Nucleotide Accession #: NM_013245
• Protein Size (# AA): 437
• Molecular Weight: 49kDa
• Protein Interactions: FBXO6; UBC; CFTR; KCND3; CHMP4B; CHMP1B; CHMP4A; CHMP2A; VPS4A; CHMP1A; CHMP4C; gag; VTA1; CHMP3; CHMP5; HGS; NPC1; BABAM1; VPS4B; RND2;